DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33160 and CG30082

Sequence 1:NP_788456.1 Gene:CG33160 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster

Alignment Length:277 Identity:72/278 (26%)
Similarity:119/278 (43%) Gaps:52/278 (19%)


  Fly     5 CLTSLFLVQILGFHSAVYAHPDSVQIQP--RIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPR 66
            |||.....|.:..:...     ::.:.|  ||:||..:.|....:|..:..:..| |.|:|:..|
  Fly    14 CLTPKLRAQFIDPNCGT-----TINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKR 73

  Fly    67 WVITAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIA----------------IRPDF-NRK 114
            :|:|||||:::.:....::        |.|.....:|..:                |...| .|:
  Fly    74 FVLTAAHCLHSFHLLTVRL--------GEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQ 130

  Fly   115 TLNMDVAALRLNSDMI-GANIETIPLAAQ--SVPARALVKVSGWGFLTADATKTAERVHSVLVPM 176
            ....|:..|:||..:: ...|..|.|...  .||..:..:.:|||.:  |...||..:.:|.:..
  Fly   131 DSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKI--DLINTATVLQTVNLIR 193

  Fly   177 WSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPL--------VYRGQLAGIVSFG-YGC 232
            ..::.|..:.|  ..::....||.: ::.|:|.|||||||        :.|....||||:| |.|
  Fly   194 LDQSDCERSLR--TSLSYGQFCAGQ-WRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC 255

  Fly   233 ASALPGIYTSVPEIRDW 249
            ..  ||:||.||...:|
  Fly   256 RG--PGVYTYVPSFTNW 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 66/246 (27%)
Tryp_SPc 34..253 CDD:238113 66/247 (27%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 67/248 (27%)
Tryp_SPc 40..274 CDD:238113 66/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24256
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.