DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LeuRS and LARS

Sequence 1:NP_001285589.1 Gene:LeuRS FlyBaseID:FBgn0284253 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_064502.9 Gene:LARS HGNCID:6512 Length:1176 Species:Homo sapiens

Alignment Length:1184 Identity:700/1185 (59%)
Similarity:889/1185 (75%) Gaps:18/1185 (2%)


  Fly     5 ERKGTFKVEYLQKIEREVQQRWEAERVHESDAPTAPKKRQAEKFFVTFPFPYMNGRLHLGHTFSL 69
            |||||.||::|:|||:|:||:|:.|||.|.:|....|:....|:|||||:|||||||||||||||
Human     3 ERKGTAKVDFLKKIEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSL 67

  Fly    70 SKAEYSMRYHRLKGRRVLWPFGFHCTGMPIKACADKLTRELEQFGFPPQFP-ETEEVVPVAAEAA 133
            ||.|:::.|.||||:..|:|||.||||||||||||||.||:|.:|.||.|| |.||....:.:..
Human    68 SKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEETSVKTE 132

  Fly   134 SEVPKDKSKGKKSKAVAKTGAAKYQWQIMQSLGLKDEEIKDFANAEHWLNYFPPLAVQDLKRIGV 198
            ..:.|||:|||||||.||.|::||||.||:||||.||||..|:.|||||:||||||:|||||:|:
Human   133 DIIIKDKAKGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKFSEAEHWLDYFPPLAIQDLKRMGL 197

  Fly   199 HVDWRRTFITTDANPYFDSFVRWQFNHLKERGKIMYGKRYTIYSPKDGQPCMDHDRSSGEGVGPQ 263
            .|||||:|||||.|||:||||||||..|:||.||.:||||||||||||||||||||.:|||||||
Human   198 KVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQ 262

  Fly   264 EYTLIKMKVLE-VPKALSSIK-QPIFMVAATLRPETMYGQTNCWLHPDIKYIAWQANKNNEVWVS 326
            ||||:|:|||| .|..||.:| :.||:||||||||||:||||||:.||:|||.:: ..|.::::.
Human   263 EYTLLKLKVLEPYPSKLSGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFE-TVNGDIFIC 326

  Fly   327 TRRAARNMTYQGFTAVEGEIKVLAEVTGQDLLGVPLSAPLTKHKVVYSLPMLSIKEDKGTGVVTS 391
            |::|||||:|||||...|.:.|:.|:.|:::||..||||||.:||:|.||||:||||||||||||
Human   327 TQKAARNMSYQGFTKDNGVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTS 391

  Fly   392 VPSDSPDDYAALVDLQKKEAFRQKYGLKDEMVLPYEPIPIIEVPTLGKLSAVHAYETLKIQSQND 456
            ||||||||.|||.||:||:|.|.|||::|:||||:||:|:||:|..|.||||...:.||||||||
Human   392 VPSDSPDDIAALRDLKKKQALRAKYGIRDDMVLPFEPVPVIEIPGFGNLSAVTICDELKIQSQND 456

  Fly   457 KDKLAEAKEMCYLKSFYDGVMLVGAFAGRKIQDVKKDLQKRLVDANEADVYYEPEKTIMSRSADE 521
            ::|||||||..|||.||:|:|||..|.|:|:|||||.:||:::||.:|.:|.||||.:||||:||
Human   457 REKLAEAKEKIYLKGFYEGIMLVDGFKGQKVQDVKKTIQKKMIDAGDALIYMEPEKQVMSRSSDE 521

  Fly   522 CVVALCNQWYLNYGEPEWQAQATKILHGMETFHEEARNNFEACLNWLHEYACSRTYGLGTKLPWD 586
            ||||||:||||:|||..|:.|.::.|..:|||.||.|.||||.|.||.|:||||||||||.||||
Human   522 CVVALCDQWYLDYGEENWKKQTSQCLKNLETFCEETRRNFEATLGWLQEHACSRTYGLGTHLPWD 586

  Fly   587 DKWLIESLSDSTIYMAFYTVVHLLQGGTFRGEKPGPFGIKPSDMTGEIWDYIFFKETPLPKKTAI 651
            ::||||||||||||||||||.||||||...|:...|.||:|..||.|:|||:||||.|.| ||.|
Human   587 EQWLIESLSDSTIYMAFYTVAHLLQGGNLHGQAESPLGIRPQQMTKEVWDYVFFKEAPFP-KTQI 650

  Fly   652 KQEHLAVLRREFEYWYPMDLRVSGKDLIQNHLTFCLYNHAAIWPNDENKWPKGMRVNGHLLLNSA 716
            .:|.|..|::|||:|||:|||||||||:.|||::.||||.|:||...:|||..:|.||||||||.
Human   651 AKEKLDQLKQEFEFWYPVDLRVSGKDLVPNHLSYYLYNHVAMWPEQSDKWPTAVRANGHLLLNSE 715

  Fly   717 KMSKSDGNFLTLTEAVDKFSADGMRLCLADAGDSVEDANFVESTADAGILRLYTFIEWVKEMLEN 781
            |||||.|||||||:|:||||||||||.||||||:||||||||:.||||||||||::||||||:.|
Human   716 KMSKSTGNFLTLTQAIDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMVAN 780

  Fly   782 RSSLRKGTDKTFNDQVFLSELNLKTQQTDENYRKMLFKEALRSGFYELQLARDKYRELCGANGMH 846
            ..|||.|...||||:||.||||....:||:||.||:|||||::||:|.|.|:|||||| ...|||
Human   781 WDSLRSGPASTFNDRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYREL-AVEGMH 844

  Fly   847 EDLVLEFIRRQALLVSPICPHMAEHVWGLLGNKESIVHARWPEVGAINEVDILCSEYLMEAAHSF 911
            .:||..||..|.||::|.|||:.||:|.|||..:||::|.||..|.:|||.|..|:||||..|..
Human   845 RELVFRFIEVQTLLLAPFCPHLCEHIWTLLGKPDSIMNASWPVAGPVNEVLIHSSQYLMEVTHDL 909

  Fly   912 RLNLKN-LLQIKGKAGKDKSVNVQAAKPNRGLVWVAKTYPPWQCCVLDTMKELFNKSQA-LPDNK 974
            ||.||| ::..|||    |:......||:...::|||.|||||...|..:::.|..:.. |||||
Human   910 RLRLKNYMMPAKGK----KTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKLPDNK 970

  Fly   975 VIAATLQQKAELKKFMKRVMPFAQMIREKVESGKGVAALAVTLEFDERQVLISNLEYLKNTLDLD 1039
            |||:.|....||||:||:||||..||:|.:|. .|...|.:.|||||:.||:.|:.||.|:|:|:
Human   971 VIASELGSMPELKKYMKKVMPFVAMIKENLEK-MGPRILDLQLEFDEKAVLMENIVYLTNSLELE 1034

  Fly  1040 VLEIKYTDDPSAPEKTREEVRPGSPFISFSVAPNVSVELTNPIERSSLFQVNTVISEGDTVQSLR 1104
            .:|:|:..:  |.:|.||:..||.|...|.:.|.|||.|.||...:..|.....|.:||...|:.
Human  1035 HIEVKFASE--AEDKIREDCCPGKPLNVFRIEPGVSVSLVNPQPSNGHFSTKIEIRQGDNCDSII 1097

  Fly  1105 EKLSKI-IGLKTDAATLKIWRYEDPVLGPRKIPNF-EDYKAGKSVLGEGNFVLDVENKKVSLEQA 1167
            .:|.|: .|:| |.:.:|:.|::||:||||::|.. ::|.....:.....|.:|:.:||:.|.:.
Human  1098 RRLMKMNRGIK-DLSKVKLMRFDDPLLGPRRVPVLGKEYTEKTPISEHAVFNVDLMSKKIHLTEN 1161

  Fly  1168 GKLTEVGRNLIYVV 1181
            |...::|..:||:|
Human  1162 GIRVDIGDTIIYLV 1175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LeuRSNP_001285589.1 PLN02959 1..1068 CDD:215518 662/1068 (62%)
nt_trans 47..>204 CDD:294020 107/158 (68%)
LeuRS_core <525..758 CDD:173906 161/233 (69%)
Anticodon_Ia_Leu_AEc 756..876 CDD:153413 74/120 (62%)
LARSNP_064502.9 tRNA-synt_1g 5..1062 CDD:330949 661/1067 (62%)
'HIGH' region 53..63 10/10 (100%)
Editing domain 260..509 156/250 (62%)
'KMSKS' region 716..720 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C327644270
eggNOG 1 0.900 E1_COG0495
Hieranoid 1 1.000
Homologene 1 1.000 H7083
Inparanoid 1 1.050 1428 1.000 Inparanoid score I115
Isobase 1 0.950 0 Normalized mean entropy S618
OMA 1 1.010
OrthoDB 1 1.010 D131349at33208
OrthoFinder 1 1.000 FOG0003696
OrthoInspector 1 1.000 T1074675
orthoMCL 1 0.900 OOG5_127407
Panther 1 1.100 LDO PTHR45794
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1447
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.