DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LeuRS and IleRS

Sequence 1:NP_001285589.1 Gene:LeuRS FlyBaseID:FBgn0284253 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_524840.2 Gene:IleRS FlyBaseID:FBgn0027086 Length:1229 Species:Drosophila melanogaster

Alignment Length:1403 Identity:269/1404 (19%)
Similarity:469/1404 (33%) Gaps:475/1404 (34%)


  Fly    19 EREVQQRWEAERVHESDAPTAPKKRQAEKFFVTFPFPYMNGRLHLGHTFSLSKAEYSMRYHRLKG 83
            |..|.|:|..|.:.|..:..:  |.:.:..|...| |:..|..|.||..:.:..:...||...:|
  Fly    23 EENVLQKWRHENIFEKCSQLS--KGKPKYTFYDGP-PFATGLPHYGHILAGTIKDIVTRYAYQQG 84

  Fly    84 RRVLWPFGFHCTGMPIKACADKLTRELEQFGFPPQFPETEEVVPVAAEAASEVPKDKSKGKKSKA 148
            ..|...||:.|.|:|::...|||..                         .:.|:|         
  Fly    85 YHVDRRFGWDCHGLPVEFEIDKLLN-------------------------IKGPED--------- 115

  Fly   149 VAKTGAAKYQWQIMQSLGLKDEEIKDFANAEHWLNYFPPLAVQDLKRIGVHVDWRRTFITTDANP 213
            |||.|.|.|..:..:.:         ...|:.|.|.        :.|:|..:|::..:.|  ..|
  Fly   116 VAKMGIAAYNAECRKIV---------MRYADEWENV--------VTRVGRWIDFKNDYKT--LYP 161

  Fly   214 YFDSFVRWQFNHLKERGKIMYGKRYTIYSPKDGQPC------MDHDRSSGEGVGPQEYTLIKMKV 272
            ::...:.|.|..|.::|.:..|.:...||    ..|      .:.:::..|.|.|  ..::.::.
  Fly   162 WYMESIWWIFKQLFDKGLVYQGVKVMPYS----TACTTSLSNFEANQNYKEVVDP--CVVVALEA 220

  Fly   273 LEVPKALSSIKQPIFMVAATLRPETMYGQTNCWLHPDIKYIAWQANKNNEVWVSTRRAARNMTYQ 337
            :.:|..        |.:..|..|.|:.....|.:||.:.|:..:..|::.::|   .|...::|.
  Fly   221 VSLPNT--------FFLVWTTTPWTLPSNFACCVHPTMTYVKVRDVKSDRLFV---LAESRLSYV 274

  Fly   338 GFTAVEGEIK-VLAEVTGQDLLGVPLSAPLTKH----KVVYSLPMLSIKEDKGTGVVTSVPSDSP 397
            ..:..|.|:| .....|.:||...||.....|.    |....|....:.||.|||:|.:.|....
  Fly   275 YKSETEYEVKEKFVGKTLKDLHYKPLFPYFAKRGAEVKAYRVLVDEYVTEDSGTGIVHNAPYFGE 339

  Fly   398 DDY-----AALVDLQKKEAFRQKYGLKDEMVLPYEPIPIIEVPTLGKLSAVHAYETLKIQSQNDK 457
            |||     |.|:             .|...||    .|:.|.   |:.:                
  Fly   340 DDYRVCLAAGLI-------------TKSSEVL----CPVDEA---GRFT---------------- 368

  Fly   458 DKLAEAKEMCYLKSFYDGVMLVGAFAGRKIQDVKKDL------QKRLVDANEADVYYEPEKTIMS 516
               .||.:                |.|:.::|..|.:      :..||.:.:....|    ....
  Fly   369 ---NEASD----------------FEGQYVKDSDKQIMAALKARGNLVSSGQVKHSY----PFCW 410

  Fly   517 RSADECVVALCNQWYLNYGEPEWQAQATKIL------HGMETFHEEARNNFEACLNWLHE---YA 572
            ||....:......|::..     :..:..:|      :.:..|.:|.|..     |||.|   :|
  Fly   411 RSDTPLIYKAVPSWFVRV-----EHMSKNLLDCSSQTYWVPDFVKEKRFG-----NWLKEARDWA 465

  Fly   573 CSRTYGLGTKLPWDDKWLIESLSDSTIYMAFYTVVHLLQGGTFRGEKPGPFGIKPSDMTGEIWDY 637
            .||....||.:|   .|...|..::.:..:...:..|             .|::..|:..|..|:
  Fly   466 ISRNRYWGTPIP---IWRSPSGDETVVIGSIKQLAEL-------------SGVQVEDLHRESIDH 514

  Fly   638 I---------------------FFKETPLPKKTAIKQEHLAV-LRREFEYWYPMDLRVSGKDLIQ 680
            |                     :|:...:|    ..|:|... ..::|...:|.|....|.|..:
  Fly   515 IEIPSAVPGNPPLRRIAPVFDCWFESGSMP----FAQQHFPFENEKDFMNNFPADFIAEGIDQTR 575

  Fly   681 NHLTFCLYNHAAIWPNDENKWP-KGMRVNGHLL-LNSAKMSKSDGNFLTLTEAVDKFSADGMRLC 743
            ......|....|::    ||.| |.:..:|.:| .:..||||...|:....|.|.|:.||.:||.
  Fly   576 GWFYTLLVISTALF----NKAPFKNLIASGLVLAADGQKMSKRKKNYPDPMEVVHKYGADALRLY 636

  Fly   744 LADAG-DSVEDANFVESTADAGILRLY--TFIEW---VKEMLENRSSLRKGTDKTFNDQ-VFLSE 801
            |.::. ...|...|.|.    |:..:.  .|:.|   .:.:|:|.....| .|...|.| .:..|
  Fly   637 LINSPVVRAESLRFKEE----GVRDIIKDVFLPWYNAYRFLLQNIVRYEK-EDLAGNGQYTYDRE 696

  Fly   802 LNLKTQQTDENYRK--------MLFKEALRSGF------YEL------------QL----ARDKY 836
            .:||      |..|        :.|||:|...|      |.|            ||    .|...
  Fly   697 RHLK------NMDKASVIDVWILSFKESLLEFFATEMKMYRLYTVVPRLTKFIDQLTNWYVRLNR 755

  Fly   837 RELCGANGMHE-----DLVLEFIRRQALLVSPICPHMAEHVW---------GLLGNKESIVHARW 887
            |.:.|..|..:     |.:.:.:.....:::|..|::.|:::         |.|.:.:|:.:...
  Fly   756 RRIKGELGADQCIQSLDTLYDVLYTMVKMMAPFTPYLTEYIFQRLVLFQPAGTLEHADSVHYQMM 820

  Fly   888 P----------------------EVGAINE--------------VDILCSEYLMEAAHSFR---- 912
            |                      |:|.:..              :.|.....::||..:.:    
  Fly   821 PVSQKKFIRNDIERSVALMQSVVELGRVMRDRRTLPVKYPVSEIIAIHKDSQILEAIKTLQDFIL 885

  Fly   913 --LNLKNLL-----------------------QIKG---------KAGKDKSV------------ 931
              ||::.|.                       ::||         ||.:|..:            
  Fly   886 SELNVRKLTLSSDKEKYGVTLRAEPDHKALGQRLKGNFKAVMAAIKALRDDEIQKQVSQGYFDIL 950

  Fly   932 ---------------------NVQAAKPNRGLVWVAKTYPPWQCC-------VLDTMKELFNKSQ 968
                                 |.:|...|..||.:..| |..:..       |::.:::|..|:|
  Fly   951 DQRIELDEVRIIYCTSEQVGGNFEAHSDNEVLVLLDMT-PNEELLEEGLAREVINRVQKLKKKAQ 1014

  Fly   969 ALP------------DNKVIAATLQQKAELKKFMKRVMPFAQMIREKVESGKGVAALAVTLEF-- 1019
            .:|            |||.....|:.:|:|.|.:..   :|.:|:..::|           ||  
  Fly  1015 LIPTDPVLIFHELAADNKAKQEVLEAQAQLAKVLSN---YASIIKTAIKS-----------EFAP 1065

  Fly  1020 ------DERQVLISNLEYLKNTLDLDVLEIKYTDDPSAPEKTREEVRPGSPFISFSVAPNVSVEL 1078
                  .:::::.|.|      :||..:.:|.|..     .|.|...|..|:::.|:|.::....
  Fly  1066 YSSEQASKKRLIASEL------VDLKGVPLKLTIC-----STEELQLPNLPWLNISLAEDLVPRF 1119

  Fly  1079 TNPIERSSLFQVNTVISEGDTVQSLREKLSKIIGL--------------KTDA----------AT 1119
            .|. .::|||..:.|..|..::.:||.:|..:.||              :|.|          ..
  Fly  1120 GNS-SKASLFLQHNVSKEIISLPTLRSELEHLFGLYGVNFNIYVVDHQKRTTALKSIDENLSGKL 1183

  Fly  1120 LKIWRYEDP-------VLGPRKIPNFEDYKAGKSVLGE 1150
            |.:.|.:|.       .|.|.....|.:..:|||:..|
  Fly  1184 LVLTRSQDAPKLSAGYELSPAPYSKFINQHSGKSIFTE 1221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LeuRSNP_001285589.1 PLN02959 1..1068 CDD:215518 244/1289 (19%)
nt_trans 47..>204 CDD:294020 33/157 (21%)
LeuRS_core <525..758 CDD:173906 55/267 (21%)
Anticodon_Ia_Leu_AEc 756..876 CDD:153413 34/170 (20%)
IleRSNP_524840.2 PLN02882 9..1094 CDD:215477 240/1269 (19%)
IleRS_core 47..>189 CDD:173909 40/196 (20%)
IleRS_core <373..650 CDD:173909 63/331 (19%)
Anticodon_Ia_Ile_ABEc 650..847 CDD:153415 39/208 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92013229
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.