DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LeuRS and MetRS

Sequence 1:NP_001285589.1 Gene:LeuRS FlyBaseID:FBgn0284253 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster

Alignment Length:1203 Identity:216/1204 (18%)
Similarity:382/1204 (32%) Gaps:471/1204 (39%)


  Fly   155 AKYQWQIMQSLGLKDEEIKDF-----ANAEHWLNYFPPLAVQDLKRIG------VHVDWRRTFIT 208
            ||...|: |.:.|.|.:.||.     ...::.|..|.|.|:.....:|      ..::|..|.:.
  Fly    22 AKQPVQV-QLVNLNDAKYKDLLVLPTLELDNGLRLFSPAAIAKYLFVGKGQQRDEWLEWSATLLA 85

  Fly   209 ------------TDAN--PYFDSFVRWQFNHLKERGKIMYGKRYTIYSPKDGQPCMDHDRSSGEG 259
                        .|||  |..::.|:...:.||                  ..|.:..|:.|...
  Fly    86 PALAHHMAVGHKADANALPVLNALVKKLDDKLK------------------ATPYLAGDKPSAAD 132

  Fly   260 VGPQEYTLIKMKVLEVPKALSSIKQPIFMVAATLRPE-TMYGQTNCWLHPDIKYIAWQANKNNEV 323
            :.                           :.:.|.|: |:.|..|.              .|...
  Fly   133 IA---------------------------IWSLLAPDGTLKGAQNV--------------DNLRD 156

  Fly   324 WVSTRRAARNMTYQGFTAVEGEIKVLAEVTGQDLLGVPLSAPL-----------TKHKVVYSLPM 377
            |.                  |.:|.|.||  |::|.   ..||           .::..::.:|:
  Fly   157 WY------------------GRVKALPEV--QEVLA---EQPLKDLSFNALQQSNRYGGLHHVPL 198

  Fly   378 --LSIKE------DKGTGVVTSVPSD------SPDDYAALVDLQKKEAFRQKYGLKDEMV---LP 425
              ||:.:      |....|..:|.::      :...|.|..:::::.....|.|.::.::   ||
  Fly   199 KRLSLADASKLLVDTTPTVADTVTNEEISAAKAAFTYTAPKEIKEERTVLPKPGERNVLITSALP 263

  Fly   426 YEPIPIIEVPTLGK-----LSA-VHA-------YETLKI------QSQNDKDKLAE---AKEMC- 467
            |    :..||.||.     ||| ::|       |.||.|      .:..:...|||   .:|:| 
  Fly   264 Y----VNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICGTDEYGTATENKALAENLTPREICD 324

  Fly   468 -YLK---SFYDGVMLVGAFAGRKIQDVKKDL-QKRLVDANEADVYYEPEKTIMSRSADECVVALC 527
             |.:   :.|....:...:.||.....:.|: |:...|..:|..       |::.|.::.:...|
  Fly   325 KYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGY-------IITESVEQLLCQKC 382

  Fly   528 NQWYLNYGEPEWQAQATKILHGM----ETFHEEAR-NNFEACLNWLHE--------YACSRTYGL 579
            :::.           |.:.:.|.    ...:|:|| :..:.|...::.        ..|:....|
  Fly   383 DRFL-----------ADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVCNSAPVL 436

  Fly   580 GTK------LP--------WDDK---------------WLIESLSDSTIYMAFYTVVHLLQGGTF 615
            .:.      ||        |.||               ||.|                       
  Fly   437 RSSDQLFIDLPKAEPQLKEWVDKSEGGWTHNAKVITRAWLKE----------------------- 478

  Fly   616 RGEKPGPFGIKPSDMTGEI-WD-------------YIFFKETPLPKKTAIKQEHLAVLRREFEYW 666
                    |:||..:|.:: |.             |::| :.|....:..|:     ..:|::.|
  Fly   479 --------GLKPRCITRDLKWGIPVPHEGFEKKVFYVWF-DAPFGYVSMTKR-----YTKEYQQW 529

  Fly   667 YPMDLRVSGKD------LIQNHLTFCLYNHAAIWPNDENKWPKGMRVNGHLL----LN--SAKMS 719
            :.   ...|.|      :.::::.|    |:.:||:......||..:..|::    ||  ..|.|
  Fly   530 WQ---PAKGTDVELFQFMAKDNVPF----HSVVWPSVLLAINKGHTLVSHIMATEYLNYEDGKFS 587

  Fly   720 KSDGNFLTLTEAVDK-FSADGMRLCLADAGDSVEDANF----------VESTADAG--ILRLYTF 771
            ||.|..:...:|.:. ..||..|..||.|....:|::|          .|...:.|  :.|...|
  Fly   588 KSRGIGVFGNDAQETGIPADVWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVF 652

  Fly   772 IEWVKEMLENRSSLRKGTDKTFNDQVFLSELNLKTQQTDENYRKMLFKEALRSGFYELQLARDKY 836
            .|      :|.||...|...|.::.|.|:.:|.:.:    .|...:.|..||.|...| ||..::
  Fly   653 CE------KNFSSTVPGVITTQDELVLLALINRELR----GYINSMEKAKLRDGVRHL-LAISRH 706

  Fly   837 RELCGANGMHED----------------------LVLEFIRRQALLVSPICPHMAEHVWGLLGNK 879
                 .||..:.                      |.:......|.|:.|..|..|..::|.|..|
  Fly   707 -----GNGYMQSQQPWVLLKGTDDQKTRASTIIGLCVNIACLLANLLFPYMPTTARTLFGQLNAK 766

  Fly   880 ESIVHARWPEVGAINEVDILCSEYLMEAAHSFRLNLKNLLQIKGKAGKDKSVNVQAAKPNRGLVW 944
            ::.::|..|.|           ..|:.|.|                        |..||      
  Fly   767 QTPLNAEKPLV-----------TLLLPAGH------------------------QIGKP------ 790

  Fly   945 VAKTYPPWQCCVLDTMKELFNKSQALPD---NKVIAATLQQKAELKKFMKRVMPFAQMIREKVES 1006
             |..:...:...:|.:|..:..:||..|   :::.||.|:         |.|...|..:||...|
  Fly   791 -APLFAKLEQSFIDELKGKYGGAQATNDAAHSQISAADLE---------KAVQAQADKVRELKAS 845

  Fly  1007 GKGVAALAVTLEFDERQVLISNLEYLKNTLDLDVLEIKYTDDPSAPEKTREEVRPGSPFISFSVA 1071
            .|..|..         |..::.|..||..|:            .|.:||.....|.:     :.|
  Fly   846 TKDKAIW---------QPEVTKLLDLKKQLE------------EAKKKTATAAAPAA-----TPA 884

  Fly  1072 PNVSVELTNPIERSSLFQVNTVISEGDTVQSLREKLSKIIGLKTDAATLKIWRYEDPVLGPRKIP 1136
            |:...:....:|::              :|...:|:.|:.|...|..   :|:            
  Fly   885 PSNGSQSVQDLEKA--------------IQEQGDKVRKLKGSTKDKT---VWQ------------ 920

  Fly  1137 NFEDYKAGKSVLGEGNFVLDVENKKVSLEQAGK 1169
                        .|.|.:||::.:..::::|.|
  Fly   921 ------------PEVNILLDLKKQLEAVQKAAK 941

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LeuRSNP_001285589.1 PLN02959 1..1068 CDD:215518 201/1101 (18%)
nt_trans 47..>204 CDD:294020 14/60 (23%)
LeuRS_core <525..758 CDD:173906 53/312 (17%)
Anticodon_Ia_Leu_AEc 756..876 CDD:153413 31/154 (20%)
MetRSNP_611382.1 GstA 1..175 CDD:223698 39/236 (17%)
GST_N_family 1..65 CDD:238319 12/44 (27%)
GST_C_family 63..164 CDD:295467 22/178 (12%)
PRK12268 254..812 CDD:237029 127/682 (19%)
MetRS_core 255..625 CDD:173907 82/436 (19%)
Anticodon_Ia_Met 634..763 CDD:153411 30/145 (21%)
MetRS_RNA 828..868 CDD:238475 14/70 (20%)
MetRS_RNA 895..938 CDD:238475 11/84 (13%)
MetRS_RNA 966..1009 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92117212
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.