DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LeuRS and lrs1

Sequence 1:NP_001285589.1 Gene:LeuRS FlyBaseID:FBgn0284253 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_594882.1 Gene:lrs1 PomBaseID:SPAC26F1.13c Length:1111 Species:Schizosaccharomyces pombe

Alignment Length:1143 Identity:539/1144 (47%)
Similarity:724/1144 (63%) Gaps:90/1144 (8%)


  Fly     1 MATTE--------------RKGTFKVEYLQKIEREVQQRWEAERVHESDAPTA-----PKKRQAE 46
            |||||              .:.|.|.:.|.::|::.||:|:.|:..|.|||..     ..:::..
pombe     1 MATTEPSVEQLETKTAKLKLENTTKRDTLIELEKKYQQKWQEEKAFEVDAPLEDVPIDELRKKYP 65

  Fly    47 KFFVTFPFPYMNGRLHLGHTFSLSKAEYSMRYHRLKGRRVLWPFGFHCTGMPIKACADKLTRELE 111
            |||...|:|||||.|||||.|:|||.|::..:.||.|:|||:|.|||||||||.|.||:|:||:|
pombe    66 KFFGNMPYPYMNGALHLGHAFTLSKVEFTTAFERLNGKRVLFPMGFHCTGMPICASADRLSREIE 130

  Fly   112 QFGFPPQF---PETEEVVPVAAE---AASEVPKDKSKGKKSKAVAKTGAAKYQWQIMQSLGLKDE 170
            .||  |.|   .|.||.|.|..:   |..:|  .|..||||||.|||.|.|||:|||:|||:...
pombe   131 MFG--PSFDVPEEKEEEVEVEVKTPNAREDV--TKHSGKKSKAAAKTAAVKYQFQIMESLGVPRT 191

  Fly   171 EIKDFANAEHWLNYFPPLAVQDLKRIGVHVDWRRTFITTDANPYFDSFVRWQFNHLKERGKIMYG 235
            ||..||:|::||:|||||..:|....|:.:||||:|||||.|||:|||||||.|||.:.|||.:|
pombe   192 EIHKFADAKYWLSYFPPLCQRDCTEFGLGIDWRRSFITTDVNPYYDSFVRWQVNHLHDSGKIKFG 256

  Fly   236 KRYTIYSPKDGQPCMDHDRSSGEGVGPQEYTLIKMKVLEVP----KALSSI---KQPIFMVAATL 293
            :|||:||.|||||||||||.|||||||||||.|||:|||.|    |||.||   .:.:.|:||||
pombe   257 ERYTVYSIKDGQPCMDHDRKSGEGVGPQEYTGIKMEVLEFPEAARKALQSIDLSNKKVCMIAATL 321

  Fly   294 RPETMYGQTNCWLHPDIKYIAWQANKNNEVWVSTRRAARNMTYQGFTAVEGEIKVLAEVTGQDLL 358
            |||||||||||::.|:|.|..:::|..||:::.|||||.||.||..:...|.:..|..:.||||:
pombe   322 RPETMYGQTNCYVGPNITYGIYESNVPNELFICTRRAANNMAYQKLSKERGVVSELGTIKGQDLI 386

  Fly   359 GVPLSAPLTKHKVVYSLPMLSIKEDKGTGVVTSVPSDSPDDYAALVDLQKKEAFRQKYGLKDEMV 423
            |..::|||:.||.||.|||.::...||||||||||||||||:|.|.:|:||..|   |.|..|. 
pombe   387 GALVNAPLSVHKQVYVLPMETVLATKGTGVVTSVPSDSPDDFATLTELRKKAEF---YHLNPEW- 447

  Fly   424 LPYEPIPIIEVPTLGKLSAVHAYETLKIQSQNDKDKLAEAKEMCYLKSFYDGVMLVGAFAGRKIQ 488
            :.||.:|||..|:.|.:.|....:.|||||..|..:||:|||:.|.:.||.|.|::|.::|.|::
pombe   448 MKYEAVPIIRTPSYGDMCAEFLCKKLKIQSPKDVKQLAQAKELAYKECFYQGTMIIGKYSGEKVE 512

  Fly   489 DVKKDLQKRLVDANEADVYYEPEKTIMSRSADECVVALCNQWYLNYGEPEWQAQATKILHGMETF 553
            ..|..::|.|:|...|.||.|||..::|||.|:|:||||:||:|:|||..|:|...|.|..:.||
pombe   513 TAKPKVRKELIDQGLAFVYNEPEGQVISRSGDDCIVALCDQWFLDYGEASWKAVTEKALDRLNTF 577

  Fly   554 HEEARNNFEACLNWLHEYACSRTYGLGTKLPWDDKWLIESLSDSTIYMAFYTVVHLLQGGTFRGE 618
            ..|.||.|...|:||.::||:|:|||||:||||.::|:|||:|||||||:||:.|||....: |:
pombe   578 SPEVRNGFLKTLDWLSQWACARSYGLGTRLPWDPQFLVESLTDSTIYMAYYTICHLLHSDVY-GK 641

  Fly   619 KPGPFGIKPSDMTGEIWDYIFFKETPLPKKTAIKQEHLAVLRREFEYWYPMDLRVSGKDLIQNHL 683
            .||...|||..||.|:||:: |::.|.||.|:|..|.||.|.|||:|:||.|:|.|||||:.|||
pombe   642 VPGALNIKPEQMTPEVWDHV-FRQAPKPKNTSISDEALARLCREFQYFYPFDIRASGKDLVPNHL 705

  Fly   684 TFCLYNHAAIWPNDENKWPKGMRVNGHLLLNSAKMSKSDGNFLTLTEAVDKFSADGMRLCLADAG 748
            |||||.|.||:  ||..||||:|.|||||:|..|||||.|||:||.||..||.||..||.|||||
pombe   706 TFCLYTHTAIF--DEKYWPKGIRANGHLLMNGEKMSKSTGNFMTLHEATKKFGADATRLALADAG 768

  Fly   749 DSVEDANFVESTADAGILRLYTFIEWVKEMLENRSSLRKGTDKTFNDQVFLSELNLKTQQTDENY 813
            |:|:||||.|:.|::.||||||...|.|||:||..:||.| ...|:|:||.:|:|...:.:.|.:
pombe   769 DTVDDANFEEALANSAILRLYTQEAWCKEMMENLDNLRTG-PYNFHDKVFENEINQLIESSREAF 832

  Fly   814 RKMLFKEALRSGFYELQLARDKYRELCGANGMHEDLVLEFIRRQALLVSPICPHMAEHVWGLLGN 878
            ...|||.||:|.||:||.|||.|||:.....||.|||..:|..|.||::...||.:||:|.....
pombe   833 SATLFKAALKSCFYDLQNARDWYREVTADRKMHRDLVCRWIETQVLLLATFAPHWSEHIWLTTLK 897

  Fly   879 KESIVH--ARWPEVGAINEVDILCSEYLM------------EAAHSFRLNLKNLLQIKGKAGKDK 929
            |...:|  .|:|:|.  :.|:...|..|:            |||           |:| :..|.|
pombe   898 KPQSIHVSGRFPQVS--SPVNTALSNSLLYIRTLSRVIREAEAA-----------QLK-RQKKGK 948

  Fly   930 SVNVQAAKPNRGLVWVAKTYPPWQCCVLDTMKELFNKSQALPDNKVIAATLQQKAELKKFMKRVM 994
            .:....:||.|..|:||:.:|.||...:..:::.:|:|:...|:|.|.:::.     ||.|||.|
pombe   949 GMLFDPSKPKRLTVFVAEKFPEWQAQYVALLQKYYNESENKFDDKAIISSVD-----KKEMKRAM 1008

  Fly   995 PFAQMIREKV-ESGKGVAALAV---TLEFDERQVLISNLEYLKNTLDLDVLEIKYTDDPSAPEKT 1055
            ||.|..::.| ..|:.|:|.::   .|.|:|.:||.....||...:.:..|.|.....|:  :|:
pombe  1009 PFIQQFKQSVINRGEHVSANSIFSRELGFNELEVLREVKPYLVRNVGIQELRIVLLQKPA--DKS 1071

  Fly  1056 REE---VRPGSPF-ISFSVAPNVSVELTNPIERSSLFQ 1089
            ...   |..||.. .:..:|||.:  .|.|.:.:.||:
pombe  1072 SAAIGLVESGSDAGATVEIAPNFA--NTVPGQPTFLFE 1107

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LeuRSNP_001285589.1 PLN02959 1..1068 CDD:215518 532/1121 (47%)
nt_trans 47..>204 CDD:294020 90/163 (55%)
LeuRS_core <525..758 CDD:173906 137/233 (59%)
Anticodon_Ia_Leu_AEc 756..876 CDD:153413 55/120 (46%)
lrs1NP_594882.1 PLN02959 21..1106 CDD:215518 533/1121 (48%)
nt_trans 66..>225 CDD:294020 90/163 (55%)
LeuRS_core <549..778 CDD:173906 137/233 (59%)
Anticodon_Ia_Leu_AEc 776..895 CDD:153413 55/120 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H7083
Inparanoid 1 1.050 969 1.000 Inparanoid score I42
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003696
OrthoInspector 1 1.000 T1125566
orthoMCL 1 0.900 OOG5_127407
Panther 1 1.100 LDO PTHR45794
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1447
TreeFam 1 0.960
1010.050

Return to query results.
Submit another query.