DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LeuRS and Lars2

Sequence 1:NP_001285589.1 Gene:LeuRS FlyBaseID:FBgn0284253 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_001335096.1 Gene:Lars2 MGIID:2142973 Length:902 Species:Mus musculus

Alignment Length:1014 Identity:193/1015 (19%)
Similarity:329/1015 (32%) Gaps:361/1015 (36%)


  Fly     8 GTFKVEYLQKIEREVQQRW------EAERVHESDAPTAPKKRQAEKFFVTFPFPYMNGRLHLGHT 66
            |.:..||..:..::|::.|      :|.||.|.|       :...||::...|||.:|:||:||.
Mouse    44 GKWTKEYTLQTRKDVEKWWHQQIKEQASRVSEED-------KLKPKFYLLSMFPYPSGKLHMGHV 101

  Fly    67 FSLSKAEYSMRYHRLKGRRVLWPFGFHCTGMPIKACADKLTRELEQFGFPPQFPETEEVVPVAAE 131
            ...:.::...|:.:::|.:|:.|.|:...|:|.:..|  :.|.|.        ||:         
Mouse   102 RVYTLSDTIARFQKMRGMQVINPMGWDAFGLPAENAA--IERNLH--------PES--------- 147

  Fly   132 AASEVPKDKSKGKKSKAVAKTGAAKYQWQIMQSLGLKDEEIKDFANAEHWLNYFPPLAVQDLKRI 196
                                       |  .||            |.:|..        :.|.|:
Mouse   148 ---------------------------W--TQS------------NIKHMR--------KQLDRL 163

  Fly   197 GVHVDWRRTFITTDANPYFDSFVRWQFNHLKERGKIMYGKRYTI-YSPKDGQPCMDHDRSSGEGV 260
            |:...|.|. |||....|: .:.::.|..|.|.| :.|.|...: :.|.| |..:.:::.:..|.
Mouse   164 GLCFSWDRE-ITTCLPDYY-KWTQYLFIKLYEAG-LAYQKEALVNWDPVD-QTVLANEQVNEYGC 224

  Fly   261 GPQEYTLIKMKVLE--------VPKALSSIKQPIFMVAATLRPETMYGQTNCWLHPDIKYIAWQA 317
            ..:....::.|.|.        ..||:..        |....|| .||......|          
Mouse   225 SWRSGAKVEKKYLRQWFIKTTAYAKAMQD--------ALADLPE-WYGIKGMQAH---------- 270

  Fly   318 NKNNEVWVSTRRAARNMTYQGFTAVEGEIKVLAEVTGQDLLGVPLSAPLTKHKVVYSLPMLSIKE 382
                  |:.             ..|...:....:|.|:| .|..|:|.....:.:|.:..::|..
Mouse   271 ------WIG-------------DCVGCHLDFTLKVDGED-TGEKLTAYTATPEAIYGISHVAISP 315

  Fly   383 DKG-------------TGVVTSVPSDSPDDYAALVDLQKKEAFRQKYGLKDEMVLPYEPIPIIEV 434
            ..|             ..:|......:|....:::.||:                  .||.|:..
Mouse   316 SHGLLHGCSSVKKALQKALVPGRDCLTPVMAVSMLTLQE------------------VPIVIMAN 362

  Fly   435 PTL-GKLSAVHAYETLKIQSQNDKD-KLAEAKEMCY---LKSFYDGV-MLVGA--FAGRKIQDVK 491
            |.| |.|.:     .:.|.|.:.:| :||:|..:.|   :::..||. .|.|:  |.|...||..
Mouse   363 PDLEGSLDS-----KIGIPSTSSEDTRLAQALGLPYSEVIEASPDGTERLSGSAEFTGMTRQDAF 422

  Fly   492 KDLQKRL----VDANEADVYYEPEKTIMSRSADECVVALCNQWYLNYGEPEWQAQATKILH---- 548
            ..|.::.    |..:           :.|....:.:::....|    |.|      ..|:|    
Mouse   423 VALTRKARGMRVGGH-----------VTSNKLKDWLISRQRYW----GTP------IPIVHCPAC 466

  Fly   549 ---------------GMETFHEEARNNFEACLNWLHEYACSRTYGLGTKLPWDDKWLIESLSDST 598
                           .:.:......:.....|.|:: .:|.|..| ..|...|   .:::..||.
Mouse   467 GPVPVPLQDLPVILPSIASLTGRGGSPLATALEWVN-CSCPRCKG-SAKRETD---TMDTFVDSA 526

  Fly   599 IYMAFYTVVHLLQGGTFRGEKPGPFGIKPSDMTGEIWDYIFFKETPLPKKTAIKQEHLAVLRREF 663
            .|...||..|..|         .|||...:|                                  
Mouse   527 WYYFRYTDPHNTQ---------SPFGSALAD---------------------------------- 548

  Fly   664 EYWYPMDLRVSGKDLIQNHL-------TFC----LYNH---------AAIWPNDENKWPKGM--- 705
             :|.|:||.:.||:....||       .||    :..|         ..:......:.|.|.   
Mouse   549 -FWMPVDLYIGGKEHAVMHLFYARFLSHFCHDQKMVKHREPFHKLLAQGLIKGQTFRLPSGQCLK 612

  Fly   706 --------------RVNGHLLLNSAKMSKSDGNFLTLTEAVDKFSADGMRLCLADAGDSVEDANF 756
                          :....|.:...|||||..|.:...|.|.::..|.:||.:..|....:|..:
Mouse   613 KEDIDFTGPAPVCAKTKEKLEVTWEKMSKSKHNGVDPEEIVAQYGIDTIRLYILFAAPPEKDILW 677

  Fly   757 -VESTADAGILRLYTFIEWVKEM-------LENRSSLRKGTDKTFNDQVFLSELNLKTQQTDENY 813
             |::.|..|:||      |.:.:       :|.|:|   ||  ....|:..|:...|.|...| |
Mouse   678 DVKTDALPGVLR------WQQRLWSLTTRFIEARTS---GT--VPQPQLLNSKEKTKAQNLWE-Y 730

  Fly   814 RKMLFKEALRSGFYELQLARDKYRELCGANG----------MH----EDLVLEFIRRQALLV--S 862
            :..:..: :.:.|.|.........:|.|.:.          :|    ||.:.      ||||  :
Mouse   731 KNAVIAQ-VTTHFTEDFALNSVVSQLMGLSSALSQASQRVVLHSPEFEDALC------ALLVMAA 788

  Fly   863 PICPHMAEHVWG---LLGNK--------ESIVHARWPEV 890
            |:.||:...:|.   |:.:|        ..::...||.|
Mouse   789 PLAPHVTSELWAGLTLVPSKLCDHYAWDSGVMLQAWPTV 827

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LeuRSNP_001285589.1 PLN02959 1..1068 CDD:215518 193/1015 (19%)
nt_trans 47..>204 CDD:294020 31/157 (20%)
LeuRS_core <525..758 CDD:173906 51/290 (18%)
Anticodon_Ia_Leu_AEc 756..876 CDD:153413 33/147 (22%)
Lars2NP_001335096.1 tRNA-synt_1g 56..900 CDD:330949 190/1003 (19%)
'HIGH' region 91..101 6/10 (60%)
'KMSKS' region 638..642 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0495
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.