DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spn28Db and Spn88Eb

Sequence 1:NP_001356884.1 Gene:Spn28Db FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster

Alignment Length:386 Identity:95/387 (25%)
Similarity:169/387 (44%) Gaps:52/387 (13%)


  Fly    23 FKLNLLELVMDKAES-NFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIM 86
            |.|.|::.:.:...| |...||......:.:....:...|..||...|:|     ..|...::::
  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL-----GWALNKQQVL 100

  Fly    87 SNF---QKHNGLRF---------TNWLYVNETYEVRQDYNTLM-KSTFMAEGK-DPLSQRKASNS 137
            .::   |:.:..|:         .|.::|:.|..|...:|||: .:|...:.| ||.:..|..|.
  Fly   101 VSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKNDPETGLKEIND 165

  Fly   138 ISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVR 202
               .|..|:|..:|.:.:...:..:...||.|..|..|.|.::|..::|.||.|..:..::..|.
  Fly   166 ---WIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVY 227

  Fly   203 MMSHVGRFR--IADHSYGQIIEMPF---------------DNSDLSMIIGLPLHNTYLSSIEKIL 250
            ||...|.|:  |.:....|||::|:               ..||:||||.||  |:...|:.:::
  Fly   228 MMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP--NSNKISLNRVI 290

  Fly   251 RTLS--------ESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK 307
            ..|:        |..:...:.:.||||:.:.:.||...|..:|::.:|:..:....|..:.....
  Fly   291 SRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLV 355

  Fly   308 INHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDK--HTVYFRG 366
            |:...|.:.|:::|.|::...|:....|...:....|.|..|.||||||.|:  .|:.|.|
  Fly   356 IDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAG 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 None
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/387 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C22676131
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D556621at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126693
Panther 1 1.100 P PTHR11461
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.