DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33120 and AT3G49190

Sequence 1:NP_788073.1 Gene:CG33120 FlyBaseID:FBgn0053120 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_190488.1 Gene:AT3G49190 AraportID:AT3G49190 Length:522 Species:Arabidopsis thaliana

Alignment Length:431 Identity:88/432 (20%)
Similarity:163/432 (38%) Gaps:105/432 (24%)


  Fly   103 KTGMLRFPKLRQKLVTCWGHYAWVNDSSGFN---INNHVLLSTH----KYRGRPVSESN--IQEY 158
            |...:|.|:...||||         |.:|.|   :..:|::..|    |.:.:.:..||  :::|
plant    56 KESFIRHPRFSSKLVT---------DENGQNQRWVRTNVVVEDHFIVPKIKPQNIENSNAFLEDY 111

  Fly   159 VSELATKYIPSDLPQWQVIVIPNSDSTQPYYILIKLHHLIIAEEEDLHVSEMLLLQDPHKKTTMT 223
            ||:|....:.:..|.|::.::....|......::|:||.:   .:.:.:..::|       ..|.
plant   112 VSDLMKIPLDTSRPLWELHLLDLKTSDAENVAVLKIHHSV---GDGMSIMSLVL-------ACMR 166

  Fly   224 LSDGLDWDSSSPKLSRFVRKPEHI---SRLINHIIHLIICRWQKFI---------YEF------- 269
            .:...|...|.|...|...:...:   ||..:.::.|:...|...|         .||       
plant   167 KTSNPDELPSLPYQYRSSSRSSLLTTGSRSDSRLLWLVKVIWTAVILGLNTVCDALEFIVTTLFV 231

  Fly   270 ESLETP-DG---STSSDQVGNLSQLMSLVVIVLV---------NVILGYIR---SRTMLKKLKRR 318
            :..||| .|   ||.|.|:..:.:.:||..|.|.         :|:||..:   ||.:.::....
plant   232 KDTETPIKGDFLSTKSKQLRLVHRTVSLDDIKLTKNAMNMTINDVVLGVTQAGLSRYLARRYGEE 296

  Fly   319 SVSYRNEVGRFQTMRLLLNRELDQRNLNWSVARNAIYKSMQPT----NLAKAL---TRFLWRLNL 376
            ....|.:....:.:||                |:|:..:::||    :||..:   ::..|. |.
plant   297 ETKNRKQKKLPKRIRL----------------RSALLVNLRPTTGIQDLADMMEKGSKCRWG-NW 344

  Fly   377 NHVLLLPYHIY-----CEFLAFADVLIKGKTSHTSTYCARLHLYVPLLLYAQLEFFKIIWELFQA 436
            ...::.|:.|.     .|.|..|...|..|   .::|.|.| .|:...:..:|...|:...:...
plant   345 FGYVVFPFSIALRDDPLEHLEIAQKTISRK---KNSYGAML-TYIFCRIIVKLLGIKVAASIINR 405

  Fly   437 PRNIYEVLFEQ---PTKELNILHKKSYAGRKIVSFSRSING 474
            ..:...:.|..   |.:|:      |:.|..|..|:.|..|
plant   406 MVSNTTMTFSNMVGPVEEV------SFYGHPITYFASSAYG 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33120NP_788073.1 Condensation 85..>199 CDD:305010 25/105 (24%)
AT3G49190NP_190488.1 Condensation 14..>181 CDD:305010 30/144 (21%)
acyl_WS_DGAT 20..488 CDD:274360 88/432 (20%)
Condensation <108..277 CDD:305010 36/179 (20%)
DUF1298 341..485 CDD:284411 24/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D828506at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR31650
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.