DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33107 and DPH5

DIOPT Version :10

Sequence 1:NP_788717.1 Gene:CG33107 / 326256 FlyBaseID:FBgn0053107 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_013273.1 Gene:DPH5 / 850869 SGDID:S000004162 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:98 Identity:22/98 - (22%)
Similarity:43/98 - (43%) Gaps:18/98 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 MFYMASGL-YENLITGVGMERLERVLDLQAAIPAMVESCHLGNDVAMALLLTIMGRYTGEPVELD 177
            ::.:..|| |::.||..|:|.:::.        :.|...|. ..:.||.....:..|.|      
Yeast     2 LYLIGLGLSYKSDITVRGLEAIKKC--------SRVYLEHY-TSILMAASQEELESYYG------ 51

  Fly   178 QKEYALKAFEMAKTVNWRQLANSGRQADLFMLI 210
             ||..|...|:.:|.: :|:.|:..:.|:..|:
Yeast    52 -KEIILADRELVETGS-KQILNNADKEDVAFLV 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33107NP_788717.1 None
DPH5NP_013273.1 PTZ00175 1..257 CDD:185500 22/98 (22%)

Return to query results.
Submit another query.