DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33107 and Dph5

DIOPT Version :9

Sequence 1:NP_788717.1 Gene:CG33107 / 326256 FlyBaseID:FBgn0053107 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_081469.2 Gene:Dph5 / 69740 MGIID:1916990 Length:281 Species:Mus musculus


Alignment Length:92 Identity:19/92 - (20%)
Similarity:37/92 - (40%) Gaps:12/92 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DLFMLIRTFSMIINCRRIREECPDWKDNLGAEIHKYFLQVRMDHSAAYGDFEMMIERFIAYCVVR 269
            |:.:..::...:|..|:|.|.......|..|:   ..|::..:|.|. |:...:.|..:...:.|
Mouse   164 DIKVKEQSLENLIRGRKIYEPPRYMSVNQAAQ---QLLEIVQNHRAR-GEEPAITEETLCVGLAR 224

  Fly   270 --------GASTTPQLCSFKISEQTNS 288
                    .|.|..|:|:..:.|..:|
Mouse   225 VGAEDQKIAAGTLQQMCTVSLGEPLHS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33107NP_788717.1 None
Dph5NP_081469.2 PTZ00175 1..272 CDD:185500 19/92 (21%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250 112..113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1798
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.