DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33107 and dph5

Sequence 1:NP_788717.1 Gene:CG33107 FlyBaseID:FBgn0053107 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001007387.2 Gene:dph5 ZFINID:ZDB-GENE-041114-85 Length:288 Species:Danio rerio

Alignment Length:170 Identity:37/171 (22%)
Similarity:63/171 (37%) Gaps:38/171 (22%)


  Fly    14 EVDEMRLGYDHESIMSFLRKSSIKHLFPYAAETTDGKQLLNRMMATLAGKLELNLQQL------- 71
            |.||:..|.|...: :||....     |:.| ||....:|..:.|.:..::..|...:       
Zfish    64 EADEILKGADVCDV-AFLVVGD-----PFGA-TTHSDLVLRALNAGIQYRVIHNASIMNAVGCCG 121

  Fly    72 LDLF----TLSIMMMT--------YQRDNVLLMKERYMMVDVVCHLAESLDSEEMFYMASGLYEN 124
            |.|:    |:||:..|        |.:    :.|.|.|.:..:|.|...:..:.|        ||
Zfish   122 LQLYNFGETVSIVFWTDTWRPESFYDK----IKKNRDMGLHTLCLLDIKVKEQSM--------EN 174

  Fly   125 LITGVGMERLERVLDLQAAIPAMVESCHLGNDVAMALLLT 164
            |:.|..:....|.:.:..|...::|......|....|.:|
Zfish   175 LMRGRKIYEPPRYMTVAQAAEQLLEILQNRRDRGEELAMT 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33107NP_788717.1 None
dph5NP_001007387.2 PTZ00175 1..270 CDD:185500 37/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1798
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.