DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33107 and Dph5

DIOPT Version :10

Sequence 1:NP_788717.1 Gene:CG33107 / 326256 FlyBaseID:FBgn0053107 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001017449.1 Gene:Dph5 / 295394 RGDID:1307867 Length:281 Species:Rattus norvegicus


Alignment Length:92 Identity:19/92 - (20%)
Similarity:37/92 - (40%) Gaps:12/92 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DLFMLIRTFSMIINCRRIREECPDWKDNLGAEIHKYFLQVRMDHSAAYGDFEMMIERFIAYCVVR 269
            |:.:..::...:|..|:|.|.......|..|:   ..|::..:|.|. |:...:.|..:...:.|
  Rat   164 DIKVKEQSLENLIRGRKIYEPPRYMSVNQAAQ---QLLEIVQNHRAR-GEAPAITEETLCVGLAR 224

  Fly   270 --------GASTTPQLCSFKISEQTNS 288
                    .|.|..|:|:..:.|..:|
  Rat   225 VGAEDQKIAAGTLQQMCTVSLGEPLHS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33107NP_788717.1 None
Dph5NP_001017449.1 PTZ00175 1..272 CDD:185500 19/92 (21%)

Return to query results.
Submit another query.