DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33107 and B0491.7

Sequence 1:NP_788717.1 Gene:CG33107 FlyBaseID:FBgn0053107 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_496427.1 Gene:B0491.7 WormBaseID:WBGene00007194 Length:274 Species:Caenorhabditis elegans

Alignment Length:189 Identity:41/190 (22%)
Similarity:73/190 (38%) Gaps:48/190 (25%)


  Fly    12 LVEVDEMRLGYDHESIMSFLRKSSIKHLF---PYAAETTDGKQLLNRMMATLAGKLELNLQQL-- 71
            ::|.|...:..:.::|::...|..:..|.   |:.| ||....:|......:..|:..|...:  
 Worm    56 IIEADRTVVEQESDAILNGADKEDVALLVVGDPFGA-TTHADLVLRAKQQNIPVKVIHNASIMNA 119

  Fly    72 -----LDLF----TLSIMMMTYQ------RDNVLLMKERYMMVDVVCHLAESLDSEEMFYMASGL 121
                 |.|:    |:||:|.|.:      .|.:.|.::|.|  ..:|.|  .:.::|.      .
 Worm   120 VGCCGLQLYNFGETVSIVMWTDEWQPESYYDKIALNRKRGM--HTLCLL--DIKTKEQ------T 174

  Fly   122 YENLITGVGMERLERVLDLQAAIPAMVESCHLGNDVAMALLLTIMGR--YTGEPVELDQ 178
            .||::.|      .::.:     ||..:.|    ..|...||||..|  ..||....|:
 Worm   175 VENMMRG------RKIFE-----PARYQKC----SEAARQLLTIYERRKAKGEECAYDE 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33107NP_788717.1 None
B0491.7NP_496427.1 PTZ00175 1..273 CDD:185500 41/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1798
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.