DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and ACOT1

DIOPT Version :10

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001032238.1 Gene:ACOT1 / 641371 HGNCID:33128 Length:421 Species:Homo sapiens


Alignment Length:119 Identity:27/119 - (22%)
Similarity:40/119 - (33%) Gaps:39/119 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 YERCPKTVEPFWVEGAGHNDVELHPHYYERLRKFLSVELVKXQLKNNVDG--GVS---------- 298
            ||..|||:|            .||..|:|....:|   |.. ::|....|  |:|          
Human   193 YEDLPKTME------------TLHLEYFEEAVNYL---LSHPEVKGPGVGLLGISKGGELCLSMA 242

  Fly   299 ----DTTSGVISNSNPAAGSASLSSKHPNPAPAAGSETSKKNVDTNVKRIENDG 348
                ..|:.|:.|.:.|....:|..|        |.......|:.|..::..||
Human   243 SFLKGITAAVVINGSVANVGGTLRYK--------GETLPPVGVNRNRIKVTKDG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA 57..280 CDD:440691 10/33 (30%)
ACOT1NP_001032238.1 Bile_Hydr_Trans 16..140 CDD:461422
alpha/beta hydrolases 145..>257 CDD:473884 19/78 (24%)
BAAT_C 203..412 CDD:430252 21/97 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.