DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and PUT2

DIOPT Version :8

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_011902.1 Gene:PUT2 / 856432 SGDID:S000001079 Length:575 Species:Saccharomyces cerevisiae

Alignment Length:48 Identity:11/48 - (22%)
Similarity:23/48 - (47%) Gaps:0/48 - (0%)


  Fly    74 SKREVQDLWLEDKFFRFLKVINLGLPMLFYGLAAIRLISHTEIVHVSE 121
            :|::..:|...|:...|||..:|......|.:.|..::...:.|:.:|
Yeast   112 AKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAE 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 11/48 (23%)
PUT2NP_011902.1 D1pyr5carbox1 29..574 CDD:273517 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 423 1.000 Inparanoid score I278
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T634711
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.