DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and 2300009A05Rik

DIOPT Version :8

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_081366.1 Gene:2300009A05Rik / 69478 MGIID:1916728 Length:157 Species:Mus musculus

Alignment Length:147 Identity:75/148 (51%)
Similarity:92/148 (62%) Gaps:14/148 (9%)


  Fly     5 RLLL------------KPRASEVLTAYLKQCHEPPWTSYFVKFHDVANDQRGMSHFNWTLENGTN 57
            ||||            |||||||||.:|.|...|.|||:.|.:..|.|||.|:|||||.: .|.|
Mouse    13 RLLLCRPWASGAASRPKPRASEVLTQHLLQRRLPHWTSFCVPYSAVHNDQFGLSHFNWPV-LGAN 76

  Fly    58 YHILRTACYPYMKYHCSKREVQDLWLEDKFFRFLKVINLGLPMLFYGLAAIRLISHTEIVHVSET 122
            ||:|||.|:|::||||||...|||..:|:||..|||||||:|.|.|||.:......||.||.|..
Mouse    77 YHVLRTGCFPFIKYHCSKAPWQDLAPQDRFFTALKVINLGIPTLLYGLGSWLFARVTETVHTSYG 141

  Fly   123 VKVPIYFLYPEDKGSSF 139
             .:.||||..||:|:.:
Mouse   142 -PITIYFLNKEDEGAMY 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 70/127 (55%)
2300009A05RikNP_081366.1 DUF4528 29..154 CDD:291690 70/127 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C197736213
eggNOG 1 0.900 E1_28K0M
Hieranoid 1 1.000
Homologene 1 1.000 H19058
Inparanoid 1 1.050 139 1.000 Inparanoid score I4468
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007396
OrthoInspector 1 1.000 T1082356
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR34651
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5034
TreeFam 1 0.960
1110.980

Return to query results.
Submit another query.