powered by:
Protein Alignment CG34148 and iqch
DIOPT Version :8
Sequence 1: | NP_788708.2 |
Gene: | CG34148 / 326250 |
FlyBaseID: | FBgn0083984 |
Length: | 139 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005159189.1 |
Gene: | iqch / 567336 |
ZFINID: | ZDB-GENE-050419-242 |
Length: | 1082 |
Species: | Danio rerio |
Alignment Length: | 95 |
Identity: | 23/95 - (24%) |
Similarity: | 31/95 - (32%) |
Gaps: | 46/95 - (48%) |
Fly 1 MQLTRLLLKPRASEV---LTAYLKQCH--EPPWT-------------------SYFVKF-----H 36
|::.|.|.| ..||| .|||:..|| ..||. |..:|| |
Zfish 684 MEVQRWLFK-IDSEVGGRGTAYVDVCHLKSRPWAQQEFIRHEPQQWRTSQSQDSVMIKFLEEVPH 747
Fly 37 DVANDQRGMSHFNWTLENGTNYHILRTACY 66
.:|:..| :..|:||
Zfish 748 LLASYAR----------------LANTSCY 761
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34148 | NP_788708.2 |
DUF4528 |
9..136 |
CDD:291690 |
20/87 (23%) |
iqch | XP_005159189.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E1_28K0M |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.