DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and aldh4a1

DIOPT Version :8

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_957452.1 Gene:aldh4a1 / 394133 ZFINID:ZDB-GENE-040426-1179 Length:556 Species:Danio rerio

Alignment Length:152 Identity:29/153 (19%)
Similarity:46/153 (30%) Gaps:57/153 (37%)


  Fly     6 LLLKPRASEVLTAY-----LKQCHEPPWTSYFVK-----FHDVANDQRGMSHFNWT--------- 51
            :|.||..:.:..:|     |::...||....||.     |.|.......::..|:|         
Zfish   223 VLWKPSDTAMSASYAVYKILRESGLPPNIIQFVPADGPVFGDTVTSSEHLAGINFTGSVPTFKRL 287

  Fly    52 ----LEN---------------GTNYHILRTAC---------------YPYMKYH-CSKREVQD- 80
                .:|               |.|:|.:..:.               |...|.. ||:..|.| 
Zfish   288 WKQVAQNLDIYKNFPRVAGECGGKNFHFVHKSADVRSVVTGTIRSAFEYGGQKCSACSRMYVPDS 352

  Fly    81 LW--LEDKFFRFLKVINLGLPM 100
            ||  :........|.|.:|.|:
Zfish   353 LWPQIRQGLLDVYKQIKVGDPV 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 28/150 (19%)
aldh4a1NP_957452.1 ALDH_F4-17_P5CDH 25..546 CDD:143441 29/153 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D293592at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.