DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and SPBC24C6.04

DIOPT Version :8

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001342759.1 Gene:SPBC24C6.04 / 2540387 PomBaseID:SPBC24C6.04 Length:548 Species:Schizosaccharomyces pombe

Alignment Length:158 Identity:25/158 - (15%)
Similarity:45/158 - (28%) Gaps:66/158 - (41%)


  Fly     6 LLLKPRASEVLTAYL--------------------------KQCHEPPWTSYFVKFHDVANDQRG 44
            :|:||....||::|:                          |.|...|   .|...|...:....
pombe   212 VLMKPSDHAVLSSYIVYQIFREAGLPAGALQFIPGDAVEVSKVCFNHP---EFAGLHFTGSTAVF 273

  Fly    45 MSHFNWTLEN-----------------GTNYHILRT-------------ACYPYMKYHCS----- 74
            .|.:....||                 |.|:|::.:             |.:.|....||     
pombe   274 RSLWGTIGENVANGKYRTYPKIVGETGGKNFHLVHSSAEIKSAVVNAVRAAFEYQGQKCSALSRL 338

  Fly    75 --KREVQDLWLEDKFFRFLKVINLGLPM 100
              .:...:....|:..:.:|.:.:|.|:
pombe   339 YVSKYAWENGFRDELTKQVKSLKVGAPL 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 24/155 (15%)
SPBC24C6.04NP_001342759.1 ALDH_F4-17_P5CDH 12..537 CDD:143441 25/158 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 460 1.000 Inparanoid score I280
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T631613
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.