DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and iqch

DIOPT Version :8

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_002933003.1 Gene:iqch / 100491266 XenbaseID:XB-GENE-964401 Length:1088 Species:Xenopus tropicalis

Alignment Length:137 Identity:30/137 - (21%)
Similarity:49/137 - (35%) Gaps:46/137 - (33%)


  Fly     1 MQLTRLLLKPRASEVL-------TAYLKQCHEPPWTSYFVKFHDVANDQ--------RG-----M 45
            :|.|.:.|:....:.|       ...|:..::..:|.:.:|:.:.|.||        ||     :
 Frog    50 IQRTEVGLRKHTEDYLHYISCNPMTLLQDGNKDKYTPHLLKWGNQAGDQNPSELPNTRGRSWGTI 114

  Fly    46 SHFNWTLENGTNYHIL---RTACYPYMKYHCSKREV--QDLWL--------------EDKFFRFL 91
            |||:    .|..:.:.   |..|.|....|   ||:  |.|.:              .||..|..
 Frog   115 SHFS----PGQQHKLFLNNRIMCNPESAAH---RELLNQSLGISLPLISTRQKTSMSNDKITRGS 172

  Fly    92 KVINLGL 98
            .|.||.:
 Frog   173 TVSNLSV 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 27/129 (21%)
iqchXP_002933003.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28K0M
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.