DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and aldh4a1

DIOPT Version :8

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001096184.1 Gene:aldh4a1 / 100124732 XenbaseID:XB-GENE-959460 Length:556 Species:Xenopus tropicalis

Alignment Length:88 Identity:19/89 (21%)
Similarity:31/89 (35%) Gaps:22/89 (25%)


  Fly     6 LLLKPRASEVLTAY-----LKQCHEPPWTSYFVK-----FHDVANDQRGMSHFNWT--------- 51
            :|.||..:.:|::|     |.:...||....||.     |.|.......:...|:|         
 Frog   223 VLWKPSDTAILSSYAVYKVLLEAGLPPNVIQFVPADGPVFGDTITSSEHLCGINFTGSVPTFKHL 287

  Fly    52 -LENGTNYHILRTACYPYMKYHC 73
             .:...|..:.||  :|.:...|
 Frog   288 WKQVAQNLDVYRT--FPRLAGEC 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 18/86 (21%)
aldh4a1NP_001096184.1 ALDH_F4-17_P5CDH 25..546 CDD:143441 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D293592at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.