DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and aldh4a1

DIOPT Version :10

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001096184.1 Gene:aldh4a1 / 100124732 XenbaseID:XB-GENE-959460 Length:556 Species:Xenopus tropicalis


Alignment Length:88 Identity:19/88 - (21%)
Similarity:31/88 - (35%) Gaps:22/88 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLKPRASEVLTAY-----LKQCHEPPWTSYFVK-----FHDVANDQRGMSHFNWT--------- 51
            :|.||..:.:|::|     |.:...||....||.     |.|.......:...|:|         
 Frog   223 VLWKPSDTAILSSYAVYKVLLEAGLPPNVIQFVPADGPVFGDTITSSEHLCGINFTGSVPTFKHL 287

  Fly    52 -LENGTNYHILRTACYPYMKYHC 73
             .:...|..:.||  :|.:...|
 Frog   288 WKQVAQNLDVYRT--FPRLAGEC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:434406 18/85 (21%)
aldh4a1NP_001096184.1 ALDH_F4-17_P5CDH 25..546 CDD:143441 19/88 (22%)

Return to query results.
Submit another query.