DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: P5CDh2 and ALDH4A1

Sequence 1:NP_788705.1 Gene:P5CDh2 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_003739.2 Gene:ALDH4A1 HGNCID:406 Length:563 Species:Homo sapiens

Alignment Length:535 Identity:257/536 (48%)
Similarity:351/536 (65%) Gaps:5/536 (1%)


  Fly    50 VANEKLLQYDEGSKERTELETALLGVLNRVEHVPIVINGQEFQAKEDFQQVLPYDIQQPIAHYGH 114
            ||||.:|.:.:||.||..|:.||..:..|:|.:|.|:..:|....:...||.|::....:|.:.:
Human    32 VANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCY 96

  Fly   115 AHRVLIQMAIDKSVEAQVKWDKVRLSDRIDIWERAAMLIAGRYRYNIIAATMLGQGKTLRQAEMD 179
            |.:.|:..||:.::.|:.:||...::||..|:.:||.:::|..|..|:|.||:|||||:.|||:|
Human    97 ADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEID 161

  Fly   180 -VAELVDFMRINPVFLRELANYEPIRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAYTPA 243
             .|||:||.|.|..:..||...:||....:.  ||...|||.||||||||||||.|..|||..||
Human   162 AAAELIDFFRFNAKYAVELEGQQPISVPPST--NSTVYRGLEGFVAAISPFNFTAIGGNLAGAPA 224

  Fly   244 LMGNSVIWKPSDSAILSNYFVFKALREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTGTST 308
            ||||.|:|||||:|:|::|.|::.|||||:|..::.||||:...|...||....|.||||||:..
Human   225 LMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVP 289

  Fly   309 VLKVLWQLVAQNINFYQNYPRLVGEGGGKNFHFVHSSAEPETAVACTIRAAFEYAGQKCSSCSML 373
            ..|.||:.||||::.:..:|||.||.|||||||||.||:.|:.|:.|:|:||||.|||||:||.|
Human   290 TFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRL 354

  Fly   374 YVPESLWQNHIREPLLEITASLVVRQDATYCDSFCSAVINRRAYDRIYMWLRYIDQSPSCQILVG 438
            |||.|||. .|:..|||..:.:.|...|....:|.||||:.:::.||..||.:...|||..||.|
Human   355 YVPHSLWP-QIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAG 418

  Fly   439 GSCDKRRGYYVDPTVVLVKDLDNIICREELLAPILGVYVYPDHKLKETMEKV-AQINHGLTGSVF 502
            |.||...||:|:|.:|..||....|.:||:..|:|.||||||.|.|||::.| :..::||||:||
Human   419 GKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVF 483

  Fly   503 AQDQNFIEEAYDAFRVNVGNLNVNDKSTGLMVGQQPFGAGHMTGTSDKLGTPHSLLRWTSPQVIK 567
            :||::.::||....|...||..:||||||.:|||||||....:||:||.|.||.:||||||||||
Human   484 SQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIK 548

  Fly   568 ESYKTHRNIFYPYMQ 582
            |::|...:..|.|||
Human   549 ETHKPLGDWSYAYMQ 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 252/522 (48%)
ALDH4A1NP_003739.2 ALDH_F4-17_P5CDH 32..553 CDD:143441 253/524 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C151347116
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S619
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003397
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.