DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: P5CDh2 and Aldh4a1

Sequence 1:NP_788705.1 Gene:P5CDh2 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001128170.1 Gene:Aldh4a1 RGDID:1624206 Length:562 Species:Rattus norvegicus

Alignment Length:535 Identity:257/536 (48%)
Similarity:355/536 (66%) Gaps:5/536 (1%)


  Fly    50 VANEKLLQYDEGSKERTELETALLGVLNRVEHVPIVINGQEFQAKEDFQQVLPYDIQQPIAHYGH 114
            ||||.:|.:.:||.||..|:.||..:.::.|.:|.|:..:|....:...|:.|::....:|.:.:
  Rat    31 VANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVVGDEEVWTSDVRYQLSPFNHGHKVAKFCY 95

  Fly   115 AHRVLIQMAIDKSVEAQVKWDKVRLSDRIDIWERAAMLIAGRYRYNIIAATMLGQGKTLRQAEMD 179
            |.:.|:..||:.:|.|:.:||...::||..|:.:||.:::|..|..|:|.||:|||||:.|||:|
  Rat    96 ADKALLNKAIEAAVLARKEWDLKPVADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEID 160

  Fly   180 -VAELVDFMRINPVFLRELANYEPIRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAYTPA 243
             .|||:||.|.|..|..||...:||....:.  |.:..|||.||||||||||||.|..|||..||
  Rat   161 AAAELIDFFRFNAKFAVELEGEQPISVPPST--NHVVYRGLEGFVAAISPFNFTAIGGNLAGAPA 223

  Fly   244 LMGNSVIWKPSDSAILSNYFVFKALREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTGTST 308
            ||||.|:|||||:|:|::|.|::.|||||:|..|:.||||:..||...||....|.||||||:..
  Rat   224 LMGNVVLWKPSDTAMLASYAVYRILREAGLPPNVIQFVPADGPTFGDTVTSSEHLCGINFTGSVP 288

  Fly   309 VLKVLWQLVAQNINFYQNYPRLVGEGGGKNFHFVHSSAEPETAVACTIRAAFEYAGQKCSSCSML 373
            ..|.||:.||||::.::.:|||.||.||||||||||||:.::.|:.|:|:||||.|||||:||.|
  Rat   289 TFKHLWKQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRL 353

  Fly   374 YVPESLWQNHIREPLLEITASLVVRQDATYCDSFCSAVINRRAYDRIYMWLRYIDQSPSCQILVG 438
            |||:|||. .|:..|||..:.:.|...|....:|.||||:.:|:.||..||.:...|||..||.|
  Rat   354 YVPQSLWP-QIKGRLLEEHSRIKVGNPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAG 417

  Fly   439 GSCDKRRGYYVDPTVVLVKDLDNIICREELLAPILGVYVYPDHKLKETMEKV-AQINHGLTGSVF 502
            |.|::..||:|:|.::..||....|.:||:..|:|.||||||.|.:||::.| :..::||||:||
  Rat   418 GQCNESVGYFVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDEKYRETLQLVDSTTSYGLTGAVF 482

  Fly   503 AQDQNFIEEAYDAFRVNVGNLNVNDKSTGLMVGQQPFGAGHMTGTSDKLGTPHSLLRWTSPQVIK 567
            |||:..::||....|...||..:||||||.:|||||||....:||:||.|.||.:||||||||||
  Rat   483 AQDKTIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIK 547

  Fly   568 ESYKTHRNIFYPYMQ 582
            |::|...:..|.|||
  Rat   548 ETHKPLGDWRYSYMQ 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 252/522 (48%)
Aldh4a1NP_001128170.1 ALDH_F4-17_P5CDH 31..552 CDD:143441 253/524 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003397
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.