DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: P5CDh2 and aldh4a1

Sequence 1:NP_788705.1 Gene:P5CDh2 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_957452.1 Gene:aldh4a1 ZFINID:ZDB-GENE-040426-1179 Length:556 Species:Danio rerio

Alignment Length:534 Identity:249/535 (47%)
Similarity:351/535 (66%) Gaps:5/535 (1%)


  Fly    50 VANEKLLQYDEGSKERTELETALLGVLNRVEHVPIVINGQEFQAKEDFQQVLPYDIQQPIAHYGH 114
            |.||.:|::.||||||.|||.||..:..:.|.:|.||..:|...|:...|:.|::....:|.:.:
Zfish    25 VKNEPVLEFKEGSKERAELEEALRNLKGKTEEIPCVIGNEEVWTKDIRFQLSPFNHSHQVAKFCY 89

  Fly   115 AHRVLIQMAIDKSVEAQVKWDKVRLSDRIDIWERAAMLIAGRYRYNIIAATMLGQGKTLRQAEMD 179
            |.:.|:..||:.||.|:.:||...:|||..|:.:||.:|:|..|..::|.||:|||||:.|||:|
Zfish    90 ADKDLLNKAIEASVAARREWDLKPVSDRAQIFFKAADIISGPKRAEVLAKTMIGQGKTVVQAEID 154

  Fly   180 VA-ELVDFMRINPVFLRELANYEPIRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAYTPA 243
            .| ||:||.|.|.....||.:.:|:.  .:...|:|..|||.|||||::|||||.|..|||.|||
Zfish   155 AAPELIDFFRFNAKHAIELEDQQPLD--SDGSTNTMLYRGLEGFVAAVAPFNFTAIGGNLAGTPA 217

  Fly   244 LMGNSVIWKPSDSAILSNYFVFKALREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTGTST 308
            ||||.|:|||||:|:.::|.|:|.|||:|:|..::.||||:...|...||....||||||||:..
Zfish   218 LMGNVVLWKPSDTAMSASYAVYKILRESGLPPNIIQFVPADGPVFGDTVTSSEHLAGINFTGSVP 282

  Fly   309 VLKVLWQLVAQNINFYQNYPRLVGEGGGKNFHFVHSSAEPETAVACTIRAAFEYAGQKCSSCSML 373
            ..|.||:.||||::.|:|:||:.||.|||||||||.||:..:.|..|||:||||.|||||:||.:
Zfish   283 TFKRLWKQVAQNLDIYKNFPRVAGECGGKNFHFVHKSADVRSVVTGTIRSAFEYGGQKCSACSRM 347

  Fly   374 YVPESLWQNHIREPLLEITASLVVRQDATYCDSFCSAVINRRAYDRIYMWLRYIDQSPSCQILVG 438
            |||:|||. .||:.||::...:.|........:|.||||:.:::.||..||.:...||..:|:.|
Zfish   348 YVPDSLWP-QIRQGLLDVYKQIKVGDPVEDFSTFFSAVIDDKSFSRIKGWLEHARSSPHLKIIAG 411

  Fly   439 GSCDKRRGYYVDPTVVLVKDLDNIICREELLAPILGVYVYPDHKLKETMEKVAQIN-HGLTGSVF 502
            |:||.::||:|:||::...|....|..||:..|:|.|||||::..|:.:..:...: :.|||::|
Zfish   412 GNCDDKKGYFVEPTIIETTDPQEKIMNEEIFGPVLTVYVYPENDYKKVLHLIDNTSPYALTGAIF 476

  Fly   503 AQDQNFIEEAYDAFRVNVGNLNVNDKSTGLMVGQQPFGAGHMTGTSDKLGTPHSLLRWTSPQVIK 567
            .||::.||||..|.|...||..:||||||.:|.|||||....:||:||.|.||.:||||||||:|
Zfish   477 PQDKSVIEEAGKALRNAAGNYYINDKSTGSIVAQQPFGGARASGTNDKPGGPHYVLRWTSPQVVK 541

  Fly   568 ESYKTHRNIFYPYM 581
            :::.......||||
Zfish   542 QTHVPLTEWKYPYM 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 245/522 (47%)
aldh4a1NP_957452.1 ALDH_F4-17_P5CDH 25..546 CDD:143441 245/524 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C151346982
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003397
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.