DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: P5CDh2 and Aldh4a1

Sequence 1:NP_788705.1 Gene:P5CDh2 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_780647.3 Gene:Aldh4a1 MGIID:2443883 Length:562 Species:Mus musculus

Alignment Length:535 Identity:254/536 (47%)
Similarity:353/536 (66%) Gaps:5/536 (1%)


  Fly    50 VANEKLLQYDEGSKERTELETALLGVLNRVEHVPIVINGQEFQAKEDFQQVLPYDIQQPIAHYGH 114
            |.||.:|.:.:||.||..|:.||..:..::|.:|.|:..:|....:...|:.|::....:|.:.:
Mouse    31 VTNEPILAFSQGSPERDALQKALKDLKGQMEAIPCVVGDEEVWTSDIQYQLSPFNHAHKVAKFCY 95

  Fly   115 AHRVLIQMAIDKSVEAQVKWDKVRLSDRIDIWERAAMLIAGRYRYNIIAATMLGQGKTLRQAEMD 179
            |.:.|:..|||.::.|:.:||...::||..::.:||.:::|..|..::|.||:|||||:.|||:|
Mouse    96 ADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEID 160

  Fly   180 -VAELVDFMRINPVFLRELANYEPIRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAYTPA 243
             .|||:||.|.|..|..||...:||....:.  |....|||.||||||||||||.|..|||..||
Mouse   161 AAAELIDFFRFNAKFAVELEGEQPISVPPST--NHTVYRGLEGFVAAISPFNFTAIGGNLAGAPA 223

  Fly   244 LMGNSVIWKPSDSAILSNYFVFKALREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTGTST 308
            ||||.|:|||||:|:|::|.|::.|||||:|..::.||||:..||...||....|.||||||:..
Mouse   224 LMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVP 288

  Fly   309 VLKVLWQLVAQNINFYQNYPRLVGEGGGKNFHFVHSSAEPETAVACTIRAAFEYAGQKCSSCSML 373
            ..|.||:.||||::.::.:|||.||.||||||||||||:.::.|:.|:|:||||.|||||:||.|
Mouse   289 TFKHLWRQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRL 353

  Fly   374 YVPESLWQNHIREPLLEITASLVVRQDATYCDSFCSAVINRRAYDRIYMWLRYIDQSPSCQILVG 438
            |||:|||. .|:..|||..:.:.|...|....:|.||||:.:|:.||..||.:...|||..||.|
Mouse   354 YVPKSLWP-QIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAG 417

  Fly   439 GSCDKRRGYYVDPTVVLVKDLDNIICREELLAPILGVYVYPDHKLKETMEKV-AQINHGLTGSVF 502
            |.|::..||||:|.::..||....|.:||:..|:|.||||||.|.:||::.| :..::||||:||
Mouse   418 GQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLQLVDSTTSYGLTGAVF 482

  Fly   503 AQDQNFIEEAYDAFRVNVGNLNVNDKSTGLMVGQQPFGAGHMTGTSDKLGTPHSLLRWTSPQVIK 567
            |||:..::||....|...||..:||||||.:|||||||....:||:||.|.||.:||||||||||
Mouse   483 AQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIK 547

  Fly   568 ESYKTHRNIFYPYMQ 582
            |::|...:..|.|||
Mouse   548 ETHKPLGDWRYSYMQ 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 249/522 (48%)
Aldh4a1NP_780647.3 ALDH_F4-17_P5CDH 31..552 CDD:143441 250/524 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C151347988
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S619
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003397
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.740

Return to query results.
Submit another query.