DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: P5CDh2 and aldh4a1

Sequence 1:NP_788705.1 Gene:P5CDh2 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001096184.1 Gene:aldh4a1 XenbaseID:XB-GENE-959460 Length:556 Species:Xenopus tropicalis

Alignment Length:535 Identity:256/536 (48%)
Similarity:342/536 (64%) Gaps:5/536 (1%)


  Fly    50 VANEKLLQYDEGSKERTELETALLGVLNRVEHVPIVINGQEFQAKEDFQQVLPYDIQQPIAHYGH 114
            |.||.:|::..||.||..|:.||..:....|.:|.|:.|:|...|:...||.|:.....:|.|.:
 Frog    25 VKNEPILEFRSGSAERAALQQALHELKATTEEIPCVVGGEEVWTKDVRYQVSPFKHSHRVAKYCY 89

  Fly   115 AHRVLIQMAIDKSVEAQVKWDKVRLSDRIDIWERAAMLIAGRYRYNIIAATMLGQGKTLRQAEMD 179
            |.:.|:..||:.::..:.:||...:.||..|:.:||.|::|..|..|:|.||:|||||..|||:|
 Frog    90 ADKELLNKAINAAMGVRKEWDLKPVQDRAQIFFKAADLLSGPRRAEILAKTMIGQGKTAIQAEID 154

  Fly   180 -VAELVDFMRINPVFLRELANYEPIRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAYTPA 243
             .|||:||.|.|..:..||.:.:||....:.  |||..|||.||:||:||||||.|..|||..||
 Frog   155 AAAELIDFFRFNAKYALELTHEQPISIPVST--NSMVYRGLEGFIAAVSPFNFTAIGGNLAGAPA 217

  Fly   244 LMGNSVIWKPSDSAILSNYFVFKALREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTGTST 308
            ||||.|:|||||:||||:|.|:|.|.|||:|..|:.||||:...|...:|....|.||||||:..
 Frog   218 LMGNVVLWKPSDTAILSSYAVYKVLLEAGLPPNVIQFVPADGPVFGDTITSSEHLCGINFTGSVP 282

  Fly   309 VLKVLWQLVAQNINFYQNYPRLVGEGGGKNFHFVHSSAEPETAVACTIRAAFEYAGQKCSSCSML 373
            ..|.||:.||||::.|:.:|||.||.|||||||||:||:.|:.|..|||:||||.|||||:||.|
 Frog   283 TFKHLWKQVAQNLDVYRTFPRLAGECGGKNFHFVHASADVESTVNGTIRSAFEYGGQKCSACSRL 347

  Fly   374 YVPESLWQNHIREPLLEITASLVVRQDATYCDSFCSAVINRRAYDRIYMWLRYIDQSPSCQILVG 438
            |||:|||. .|:..|||..|.:.|...|....||.||||:::::.||..|:.:...||...||.|
 Frog   348 YVPDSLWP-RIKARLLEEHAKIKVGDPADDFSSFFSAVIDQKSFRRIQGWISHAQSSPDLAILAG 411

  Fly   439 GSCDKRRGYYVDPTVVLVKDLDNIICREELLAPILGVYVYPDHKLKETMEKVAQIN-HGLTGSVF 502
            |.||...||||.||::..|:....|..||:..|:|.|||||:...:|.::.:...: :||||:||
 Frog   412 GKCDDSEGYYVQPTIIESKNPKEKIMAEEIFGPVLAVYVYPESNYREVLQLIDSTSPYGLTGAVF 476

  Fly   503 AQDQNFIEEAYDAFRVNVGNLNVNDKSTGLMVGQQPFGAGHMTGTSDKLGTPHSLLRWTSPQVIK 567
            |||:|.:.||....|...||..:||||||.:|.|||||....:||:||.|.||.:||||||||:|
 Frog   477 AQDKNVLREATQILRHAAGNFYINDKSTGAVVAQQPFGGSRASGTNDKPGWPHYILRWTSPQVVK 541

  Fly   568 ESYKTHRNIFYPYMQ 582
            |::.......|||||
 Frog   542 ETHVPLTEWKYPYMQ 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 251/522 (48%)
aldh4a1NP_001096184.1 ALDH_F4-17_P5CDH 25..546 CDD:143441 251/524 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C151347513
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003397
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.