DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32985 and CG11630

Sequence 1:NP_788013.2 Gene:CG32985 FlyBaseID:FBgn0052985 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster

Alignment Length:677 Identity:170/678 (25%)
Similarity:290/678 (43%) Gaps:104/678 (15%)


  Fly     7 YSFKRLIVSFLAVTLICLWSMNSSRVDENFSARDSQEVEKLFYVESGKCKMRYV--NPFNAEFLK 69
            :.:..:|.||       ::..|...|| |....:...||| :.|::..|:|..:  |.::..||.
  Fly    10 FLYSLIIFSF-------VYYYNDVVVD-NIIFEEHHLVEK-YSVDTKGCRMLTMVPNEYDVMFLW 65

  Fly    70 INHPKAFIPCTNESDLISVHYDKILNQYVLHTNEEVLHELSESK-----TNDFACFY-------- 121
            ....:.|  |.:..:|.|  :......|:   ..||..||::::     ...|.|.|        
  Fly    66 RGLRRDF--CASNLNLTS--FSNCTYNYL---RTEVNMELAKARFGVETLESFKCMYYAMERHTD 123

  Fly   122 --QKIIYGQSAEHY-DGKGVKTKISQNHLVPLDVEGMLVEC---RTADEMRVLQRDAFVFVQYKD 180
              .:.:|.:..|.. ||         |:.:....:.:..||   .|:     :......:|...|
  Fly   124 FDNRYLYSREFELLTDG---------NNTIEPHADIIRAECFINATS-----IYNGVHFYVHPTD 174

  Fly   181 ----PPQNVKPVKKA------SVIMYGIDTVSRTNLRRMMPMVFEFLKSPGWYEMMGYNKVADNS 235
                ..|.:.|:|.|      ||::.|:|::|:.:..|.|.....||.|....|:.|:|::.::.
  Fly   175 EWLRTAQGLPPLKLASDVGSLSVLIVGLDSISQMHFHRSMARTANFLLSLPHVELKGFNRLGEDG 239

  Fly   236 FPNIFAMLTGFSPESAETQICNTDVDGCLDKIPFIWKDFKKDGYLTAYAEDEEHSNTFNYAKPGF 300
            |.::..:|:|.|.:..:....|.   ..||..|||||.|:|.||.|...||....:.|   ..||
  Fly   240 FDSLMPLLSGLSGQELKDVSSNL---SSLDSCPFIWKVFQKAGYETGLGEDNIDKSLF---VKGF 298

  Fly   301 AVKPTDYYFRPFLTALENETFIQYCPGCVMKYCLGRRLASSYIFDYCRQFMQRFVADRPIWGMFW 365
            ...|||:|.||.|..:..:|   ...|....:|..:...:..:.::..:.:....:.|....::|
  Fly   299 RKPPTDFYLRPALLEMWLKT---RTDGLFGTHCNEKDNYAMVLREFLFKMLPHHTSHRFFTFLWW 360

  Fly   366 TNHYSHDDLFMLS-AMQHKILEDLLSFEKDGVFEHTIMIFFSDHGARFGPLMYTKEAFLEERLPM 429
            |....|  ||... .:....|:...:..:.|:.::|:::..|:||...|....|.:..:||..|:
  Fly   361 TQGIDH--LFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEESQPL 423

  Fly   430 MFIYLPPWFRKKYPRYVEALAQNQNRLSSNFDLYNTLKHIINIEGLVEDTK--------WSY--D 484
            ..:..|.|..::||:.:..|..|..||.:.|||:.||:::.|:..| ||.:        |:.  |
  Fly   424 AILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSL-EDEQLQQRRVDLWAMGKD 487

  Fly   485 CPQCQSLFYPLPESRSCSEAAIPEAYCTCHNYEEIKEDQG-TWRLANLVVDRMNKYLHYHNLQNL 548
            .|:..|||.|:|:.|.|..||||.|.|.|.....:....| ..|.|.|::..:||.:|.|...  
  Fly   488 IPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNLNKMIHTHTPP-- 550

  Fly   549 CSNLTL-RVINSTEVRMDDKDVDLANGMRHYHTKFQVH----QNLAEFFATVLYDKQTEELQMNV 608
            |..|.| ||:.:      ||...:|:   .:.::|:|.    ....:|...|.|......:..: 
  Fly   551 CKTLYLDRVLTA------DKWRRIAD---EHQSEFRVRLIATPGEGQFEGIVRYTGYKLAVDGH- 605

  Fly   609 ELISRTNMYGTDSECVNNKIQKLYCVC 635
              |||.|.|...|:|:.|.:.::||.|
  Fly   606 --ISRVNDYRNGSQCIRNYLIEMYCFC 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32985NP_788013.2 None
CG11630NP_610124.1 DUF229 66..560 CDD:281053 135/529 (26%)
ALP_like 195..467 CDD:293745 76/283 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49317
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.