DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32985 and M03F8.5

DIOPT Version :8

Sequence 1:NP_788013.2 Gene:CG32985 / 326244 FlyBaseID:FBgn0052985 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_504546.2 Gene:M03F8.5 / 187431 WormBaseID:WBGene00019764 Length:417 Species:Caenorhabditis elegans

Alignment Length:457 Identity:105/458 (23%)
Similarity:171/458 (37%) Gaps:110/458 (24%)


  Fly     3 RSISYSFKRLIVSFLAVTLICLWSMNSSRVDENFSA------RDSQEVEKLFYVESGKCKMRYVN 61
            |:||    .||...|..:||||:.: .|:...||..      |:..|..:..::....||..:.:
 Worm     5 RTIS----ALIQIVLITSLICLFYI-VSQSHLNFKPNLKLEFRNFSEPHRQAHLFDNYCKFAWTD 64

  Fly    62 PFNAEFLK-INHPK------------AFIPCTNESDLISVHYDKILN---QYVLHTNEEVLHELS 110
            |.::...| :..||            ...|.|.|..:....|...|.   |.:........|...
 Worm    65 PMDSTLKKRLKFPKHASCEKYNIDLFKRYPATGEFSMKLKSYKNNLECVAQVLKGGLRPEAHTFK 129

  Fly   111 ESKTNDFA-----------------CF-YQKIIYGQSAEHYDGKGVKTKISQNHLVPLDVEGMLV 157
            ..:|.:|:                 || .|.:||   .:.:.|..::.|:      ||.|:|.. 
 Worm   130 LGRTQNFSPKLNKRFWINADNFLITCFSKQLVIY---RKQFMGLNMQEKL------PLVVDGSF- 184

  Fly   158 ECRTADEMRVLQRDAFVFVQYKDPPQNVKPVKKASVIMYGIDTVSRTNLRRMMPMVFEFLKSPGW 222
                     |:....:.|...|.        .:.|:.:.|:|:.||....|.|......|...|.
 Worm   185 ---------VIPEPDYTFHGEKS--------TRFSISILGLDSTSRAQFGRNMKKTSGLLDRLGS 232

  Fly   223 YEMMGYNKVADNSFPNIFAMLTGFSPESAETQIC-------NTDVDGCL--------DKIPFIWK 272
            .....||||.|||..|   ||..|:.|..||:..       :.:::..|        |.|.:|||
 Worm   233 VVFNAYNKVGDNSAVN---MLPIFANELQETESMSLIDETGDVNINKILPSKTPLNPDTIQWIWK 294

  Fly   273 DFKKDGYLTAYAEDEEHSN--TFNYAKP----GFAVKPTDYYFRPFLTALENETFIQYCPGCVMK 331
            ....: |:|.|.:|..|::  .|:|...    ||:..|..:|:||:...|..:....:      :
 Worm   295 QLPPE-YITMYNDDIMHTSRGLFHYPPDNFLGGFSKPPAKFYYRPYYNHLYTQMNNWW------R 352

  Fly   332 YCL-GRRLASSYIFDYCRQFMQRFVADRPIWGMFWTNHYSHDDLFMLSAMQHKILEDL----LSF 391
            .|| |:.||..:|..:.|  .:|.....|.:|..:.:..:|||...|:.:.:.:...|    |.|
 Worm   353 KCLDGQLLAEVFIDSWFR--FERVFGKLPHFGFTFISSLTHDDPNNLNLLDNTLYHRLEYLNLIF 415

  Fly   392 EK 393
            :|
 Worm   416 KK 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32985NP_788013.2 None
M03F8.5NP_504546.2 ALP_like 201..>391 CDD:304875 53/202 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49676
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.