DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and AT4G05240

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_192433.1 Gene:AT4G05240 / 825872 AraportID:AT4G05240 Length:197 Species:Arabidopsis thaliana


Alignment Length:188 Identity:38/188 - (20%)
Similarity:67/188 - (35%) Gaps:49/188 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ 78
            :::::|.:.:|....|.| ...:..:.     |.||::.|     :.:.|..|           |
plant     6 SIQIKPPNRVEGFSGKCQ-YTAVSSNA-----AKKQMKMG-----FAVHKPKT-----------Q 48

  Fly    79 IF-----------VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 132
            |:           |..|......:|:...||:..:|.||:..:.|...:|.|.|.|..|:|...:
plant    49 IWRQRSLSFKCSRVWKLPNYKFEIELGYWDTVLEIKQKIEKYQRILVYRQTLFFQGNVLQDHLDI 113

  Fly   133 SDYNIQKESTLHLVLRLRGGMQIFVKTLTG----KTITLEVEPSDTIENVK--AKIQD 184
            ....|...|.|          ::||.....    ....|:.|.|..:.:.|  ..:||
plant   114 EQCVILNHSLL----------KVFVDPYRNPNHDNDQMLQTEESPPLNSAKEIVNVQD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 10/61 (16%)
Ubl_ubiquitin 77..152 CDD:340501 20/85 (24%)
Ubl_ubiquitin 153..228 CDD:340501 8/38 (21%)
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
AT4G05240NP_192433.1 ubiquitin 65..130 CDD:459726 19/74 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.