DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and AT2G32350

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_180794.2 Gene:AT2G32350 / 817796 AraportID:AT2G32350 Length:242 Species:Arabidopsis thaliana


Alignment Length:236 Identity:54/236 - (22%)
Similarity:104/236 - (44%) Gaps:37/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST------------- 66
            :|:...:::..||.::.....||.....|..:..:|.||..:.||.|....|             
plant     1 MEISEQESVLEVKKRLGQFLQIPTSSITLFVSCWELIDGLDIEDYPIISHGTRIDLTVTPLFTAP 65

  Fly    67 --LHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL-ED 128
              :|..:|   .:.:.|| ...|..|:||:.::|:.::|.||...|..|..:.:|.::|.:| :|
plant    66 SFIHAAVR---KIHVTVK-FPSKQFTVEVDRTETVSSLKDKIHIVENTPIKRMQLYYSGIELADD 126

  Fly   129 GRTLSDYNIQKESTLHLVL-------------RLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA 180
            .|.|::|.|.:.|.:.:.|             :|...:|.......|..|.:|::.:.||..::.
plant   127 YRNLNEYGITEFSEIVVFLKSINRAKDVAPVRKLCFLVQTSSSLFNGARIPVEIKDTCTISEMRE 191

  Fly   181 KIQDKEGIPPDQQRLIFAGKQ--LEDGRTLSDYNIQKESTL 219
            .:|..:.:|.|:  .||..||  :.:..:|..:.::...||
plant   192 GLQANKTLPRDE--YIFVHKQRIMRENCSLRWHGVENGDTL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 15/75 (20%)
Ubl_ubiquitin 77..152 CDD:340501 23/88 (26%)
Ubl_ubiquitin 153..228 CDD:340501 16/69 (23%)
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
AT2G32350NP_180794.2 ubiquitin 1..47 CDD:459726 11/45 (24%)
ubiquitin 77..146 CDD:459726 21/69 (30%)
Ubl_ubiquitin_like 172..233 CDD:340559 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.