DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and RAD23B

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_002865.1 Gene:RAD23B / 5887 HGNCID:9813 Length:409 Species:Homo sapiens


Alignment Length:68 Identity:24/68 - (35%)
Similarity:44/68 - (64%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
            ||:.:|||..:|..::::|.:|::.:|.||:.::|   .|...|:||:|||.|.|...|.:|.|.
Human     1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKID 65

  Fly    63 KES 65
            :::
Human    66 EKN 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 24/68 (35%)
Ubl_ubiquitin 77..152 CDD:340501
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
RAD23BNP_002865.1 rad23 1..407 CDD:273167 24/68 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..175
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..276
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.