DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and UBQLN4

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_064516.2 Gene:UBQLN4 / 56893 HGNCID:1237 Length:601 Species:Homo sapiens


Alignment Length:77 Identity:27/77 - (35%)
Similarity:43/77 - (55%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RGGMQIFVKTLTGKTITLEVEPSD--TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136
            |..:::.|||...|.   |:...|  :::..|.:|..:.....||..||||||.|:||.||:.:.
Human    10 RPPIRVTVKTPKDKE---EIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHG 71

  Fly   137 IQKESTLHLVLR 148
            |:...|:|||::
Human    72 IKDGLTVHLVIK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 1/1 (100%)
Ubl_ubiquitin 77..152 CDD:340501 26/74 (35%)
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
UBQLN4NP_064516.2 Ubl_PLICs 11..83 CDD:340506 26/74 (35%)
rad23 13..>291 CDD:273167 26/74 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..155
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..366
STI1 393..>424 CDD:128966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 490..533
UBA_PLICs 558..597 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.