DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and Ubd

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_445751.2 Gene:Ubd / 29168 RGDID:69418 Length:161 Species:Rattus norvegicus


Alignment Length:153 Identity:46/153 - (30%)
Similarity:73/153 - (47%) Gaps:20/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM 77
            :|.:...||.::.:...|:.:..:....|.|:...|.|:..|.||.|.|.||:|:||.|::    
  Rat    16 MTFDTTMSDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRALSSYGIDKENTIHLTLKV---- 76

  Fly    78 QIFVKTL-------------TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG 129
               ||..             .|:...|.|..|.::..||..|::...:||.:|.:...||:||||
  Rat    77 ---VKPSDEELPLSLVESGDEGQRHLLRVRRSSSVAQVKEMIENVTAVPPKKQFVNCNGKRLEDG 138

  Fly   130 RTLSDYNIQKESTLHLVLRLRGG 152
            :.::||||:..|.|.|.....||
  Rat   139 KIMADYNIKSGSLLFLTAHCIGG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 19/62 (31%)
Ubl_ubiquitin 77..152 CDD:340501 25/87 (29%)
Ubl_ubiquitin 153..228 CDD:340501 46/153 (30%)
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
UbdNP_445751.2 Ubl1_cv_Nsp3_N-like 8..78 CDD:475130 19/68 (28%)
Ubl2_FAT10 86..155 CDD:340573 22/68 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.