DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and Rad23b

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_033037.2 Gene:Rad23b / 19359 MGIID:105128 Length:416 Species:Mus musculus


Alignment Length:105 Identity:31/105 - (29%)
Similarity:54/105 - (51%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
            ||:.:|||..:|..::::|.:|::.:|.||:.::|   .|...|:||:|||.|.|...|.:|.|.
Mouse     1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALKEYKID 65

  Fly    63 KESTLHLVLRLRGGMQIFVKTLTGKTITLEV----EPSDT 98
            :::.            :.|.....|.:|..|    :||.|
Mouse    66 EKNF------------VVVMVTKPKAVTTAVPATTQPSST 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 24/77 (31%)
Ubl_ubiquitin 77..152 CDD:340501 7/26 (27%)
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
Rad23bNP_033037.2 rad23 1..414 CDD:273167 31/105 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..175 4/11 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..356
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.