DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp2 and arp2

Sequence 1:NP_001259621.1 Gene:Arp2 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001342919.1 Gene:arp2 PomBaseID:SPAC11H11.06 Length:390 Species:Schizosaccharomyces pombe

Alignment Length:386 Identity:249/387 (64%)
Similarity:304/387 (79%) Gaps:6/387 (2%)


  Fly     9 IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLMVGDEASQLRSLL 73
            ||.||||||||.|||..|||...|||:||||::||..|.|::::|     |:||||||..:||||
pombe     6 IVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIK-----DVMVGDEAEAVRSLL 65

  Fly    74 EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMFEKYGF 138
            :|.||||||::|::::|..:|||||. :|:.|||...|||||||||||..|||||.|.|||:|||
pombe    66 QVKYPMENGIIRDFEEMNQLWDYTFF-EKLKIDPRGRKILLTEPPMNPVANREKMCETMFERYGF 129

  Fly   139 DSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLL 203
            ...|:||||||:||||||.||||:|||||||||.||||...|.||..|||:||||.|||||.|||
pombe   130 GGVYVAIQAVLSLYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLVGRLDVAGRDATRYLISLLL 194

  Fly   204 LRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPE 268
            .:|||||.:|||||||.|||||||:.||:|::.:|:.|||||:.:||||||||||||.||:|.||
pombe   195 RKGYAFNRTADFETVREMKEKLCYVSYDLELDHKLSEETTVLMRNYTLPDGRVIKVGSERYECPE 259

  Fly   269 ALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLEREIKQLYLER 333
            .||||||:..|.||::|..|:||||||:|||..||:.|||||||:||.|||||||:|||||:.||
pombe   260 CLFQPHLVGSEQPGLSEFIFDTIQAADVDIRKYLYRAIVLSGGSSMYAGLPSRLEKEIKQLWFER 324

  Fly   334 VLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQGLKVLQKL 394
            ||..|..:|..||::|||.|||:..|||||||||::....|..|:||.|::|.|::.|.||
pombe   325 VLHGDPARLPNFKVKIEDAPRRRHAVFIGGAVLADIMAQNDHMWVSKAEWEEYGVRALDKL 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 247/384 (64%)
arp2NP_001342919.1 ACTIN 4..382 CDD:214592 246/382 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4181
Inparanoid 1 1.050 517 1.000 Inparanoid score I223
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002576
OrthoInspector 1 1.000 T1124495
orthoMCL 1 0.900 OOG5_128705
Panther 1 1.100 LDO PTHR11937
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R82
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.