DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp2 and actr2a

Sequence 1:NP_001259621.1 Gene:Arp2 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_021326108.1 Gene:actr2a ZFINID:ZDB-GENE-040426-2894 Length:399 Species:Danio rerio

Alignment Length:394 Identity:323/395 (82%)
Similarity:364/395 (92%) Gaps:0/395 (0%)


  Fly     1 MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLMVGDE 65
            |||:|:.|:|||||||||||||||||||.||||::||||:||:..|:|:||:||....|||||||
Zfish     1 MDSQGKKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTAKVGNIEIKDYRRMDLMVGDE 65

  Fly    66 ASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIE 130
            ||:|||:|||:||||||:|||||||.|:|||||||:|::||..|.|||||||||||||||||:||
Zfish    66 ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDSRNCKILLTEPPMNPTKNREKIIE 130

  Fly   131 VMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDIT 195
            ||||.|.|...|||||||||||||||::|||:||||||||||||||.|:||||||||||||||||
Zfish   131 VMFETYQFSGVYIAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDIT 195

  Fly   196 RYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVLVESYTLPDGRVIKVG 260
            ||||||||||||||||||||||||:|||||||:||:||.||:|||||||||||||||||||||||
Zfish   196 RYLIKLLLLRGYAFNHSADFETVRMMKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRVIKVG 260

  Fly   261 GERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLERE 325
            ||||||||||||||||||||.|:|||.||||||||||.|.|.|||||||||||||||||||||||
Zfish   261 GERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRAEFYKHIVLSGGSTMYPGLPSRLERE 325

  Fly   326 IKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQGLKV 390
            :||||||||||.|.:||:|||||||||||||.|||:||||||::.||:|.|||:::||||:|.:|
Zfish   326 LKQLYLERVLKGDVDKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTREEYQEKGTRV 390

  Fly   391 LQKL 394
            |:||
Zfish   391 LEKL 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 317/387 (82%)
actr2aXP_021326108.1 ACTIN 6..393 CDD:214592 317/387 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C228956787
eggNOG 1 0.900 E1_COG5277
Hieranoid 1 1.000
Homologene 1 1.000 H4181
Inparanoid 1 1.050 676 1.000 Inparanoid score I677
OMA 1 1.010
OrthoDB 1 1.010 D280976at33208
OrthoFinder 1 1.000 FOG0002576
OrthoInspector 1 1.000 T596490
orthoMCL 1 0.900 OOG5_128705
Panther 1 1.100 LDO PTHR11937
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.