DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp2 and Arp3

Sequence 1:NP_001259621.1 Gene:Arp2 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001261559.1 Gene:Arp3 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster

Alignment Length:430 Identity:141/431 (33%)
Similarity:208/431 (48%) Gaps:86/431 (20%)


  Fly    10 VCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIE-------VKDLHVDDLMVGDEAS 67
            |.|.|||:.|.|:||:..|..|.||.:.   |:...::||..       ::||   |..:||||.
  Fly     9 VIDVGTGYSKLGFAGNKEPQFIIPSAIA---IKESARVGDTNTRRITKGIEDL---DFFIGDEAF 67

  Fly    68 QLRSLLEVSYPMENGVVRNWD------DMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNRE 126
            .... ..:.||:.:|:|.:||      :.| |:.|      :..:|.:...||||||:|..:|||
  Fly    68 DATG-YSIKYPVRHGLVEDWDLMERFLEQC-VFKY------LRAEPEDHYFLLTEPPLNTPENRE 124

  Fly   127 KMIEVMFEKYGFDSAYIAIQAVLTLYA--------QGLISGVVIDSGDGVTHICPVYEEFALPHL 183
            ...|:|||.:.....|||:||||.|.|        :..::|:|:||||||||:.||.|.:.:...
  Fly   125 YTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSC 189

  Fly   184 TRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVLVES 248
            .:.:.||||:||.::..||..|..........||.:.:|||.|||..||..|          ...
  Fly   190 IKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKE----------FAK 244

  Fly   249 YTLPDGRVIK----------------VGGERFEAPEALFQPHLINVEGP-GIAELAFNTIQAADI 296
            |....|:.|:                ||.|||..||..|.|...|.:.. .::|:..|.||...|
  Fly   245 YDTEPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPI 309

  Fly   297 DIRPELYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDM--- 358
            |:|..||.:|||||||||:.....||:|:||:....|:  ..:|.|::.:|:    |:..|:   
  Fly   310 DVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRL--RISENLSEGRIK----PKPIDVQVI 368

  Fly   359 --------VFIGGAVLAEVTKDRDGFWM---SKQEYQEQG 387
                    |:.||::||...:    |:.   :|..|:|.|
  Fly   369 THHMQRYAVWFGGSMLASTPE----FYQVCHTKAAYEEYG 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 141/431 (33%)
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 141/431 (33%)
COG5277 6..410 CDD:227602 141/431 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104563525
eggNOG 1 0.900 E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D649708at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11937
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.