DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp2 and Act5C

Sequence 1:NP_001259621.1 Gene:Arp2 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001014725.1 Gene:Act5C FlyBaseID:FBgn0000042 Length:376 Species:Drosophila melanogaster

Alignment Length:385 Identity:180/386 (47%)
Similarity:251/386 (65%) Gaps:20/386 (5%)


  Fly     9 IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLMVGDEASQLRSLL 73
            :|.|||:|..|.|:||.:.|..:|||:||||..:.| .:|      :...|..|||||...|.:|
  Fly     9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG------MGQKDSYVGDEAQSKRGIL 66

  Fly    74 EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMFEKYGF 138
            .:.||:|:|:|.|||||..:|.:|| ..::.:.|....:||||.|:||..|||||.::|||.:..
  Fly    67 TLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 130

  Fly   139 DSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLL 203
            .:.|:||||||:|||.|..:|:|:||||||:|..|:||.:||||...|||:||||:|.||:|:|.
  Fly   131 PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILT 195

  Fly   204 LRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPE 268
            .|||:|..:|:.|.||.:||||||:..|.|.|...|..::.|.:||.||||:||.:|.|||..||
  Fly   196 ERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPE 260

  Fly   269 ALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLEREIKQLYLER 333
            |||||..:.:|..||.|..:|:|...|:|||.:||.:.|||||:|||||:..|:::||..|    
  Fly   261 ALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL---- 321

  Fly   334 VLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQGLKVLQK 393
                   ..:..||:|..||.||..|:|||::||.::..:. .|:|||||.|.|..::.:
  Fly   322 -------APSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ-MWISKQEYDESGPSIVHR 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 180/384 (47%)
Act5CNP_001014725.1 PTZ00281 1..376 CDD:173506 180/386 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104210648
eggNOG 1 0.900 E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D649708at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11937
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.