DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and YPL109C

DIOPT Version :8

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_015216.3 Gene:YPL109C / 855995 SGDID:S000006030 Length:657 Species:Saccharomyces cerevisiae

Alignment Length:96 Identity:17/97 (18%)
Similarity:38/97 (39%) Gaps:23/97 (24%)


  Fly   121 LRIRRQLADLVRCSELGRARISALDRLFQRQTKELVGCRQDHERVLSFHLTKQLEAGKCLQRY-- 183
            |..::|:.|:..|.::....:.|..::.                :|...:...|..|..:.|:  
Yeast   376 LSTKKQINDVELCKKVSDPFVDAFLQML----------------ILDDFVHADLHPGNVIIRFVK 424

  Fly   184 --RYARDLYASWRELFKMGRHLKEAYKKILE 212
              :|..::.:|..|.:::...|:   |||.|
Yeast   425 TNKYGTNIISSELESYRITHDLR---KKIEE 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 17/97 (18%)
YPL109CNP_015216.3 AarF 100..610 CDD:223733 17/97 (18%)
ADCK2-like 200..538 CDD:270873 17/97 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.