DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and COQ8B

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_079152.3 Gene:COQ8B / 79934 HGNCID:19041 Length:544 Species:Homo sapiens


Alignment Length:206 Identity:44/206 - (21%)
Similarity:72/206 - (34%) Gaps:77/206 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GGRSCWEEE--QEALAKGLEPEDSRWMIMHGSREAALRELQWNNLRIRRQLADLVRCSELGRARI 141
            ||  .|.::  |:...:||..||.|     .:|||..|:..      |.||:|..|..::..:||
Human    38 GG--SWAQKFYQDGPGRGLGEEDIR-----RAREARPRKTP------RPQLSDRSRERKVPASRI 89

  Fly   142 SALDR------------LFQRQTKELVGCR-----------------QDHERVLSFHLTKQ---L 174
            |.|..            |.:...|.:.|.|                 .:.||::....|.:   |
Human    90 SRLANFGGLAVGLGLGVLAEMAKKSMPGGRLQSEGGSGLDSSPFLSEANAERIVQTLCTVRGAAL 154

  Fly   175 EAGKCL----------------QRYRYARDLYASWRELFKMGRHLKEAYKKILERTQSRLEYAEI 223
            :.|:.|                :|.|.:.|....|:.|            ::||....|...|::
Human   155 KVGQMLSIQDNSFISPQLQHIFERVRQSADFMPRWQML------------RVLEEELGRDWQAKV 207

  Fly   224 KRQALDEMTVA 234
              .:|:|:..|
Human   208 --ASLEEVPFA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 44/206 (21%)
COQ8BNP_079152.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..86 15/51 (29%)
KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 155..158 0/2 (0%)
ABC1_ADCK3 175..424 CDD:270872 12/56 (21%)
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 216..219 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.