Sequence 1: | NP_727647.1 | Gene: | CG32650 / 326227 | FlyBaseID: | FBgn0052650 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079152.3 | Gene: | COQ8B / 79934 | HGNCID: | 19041 | Length: | 544 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 44/206 - (21%) |
---|---|---|---|
Similarity: | 72/206 - (34%) | Gaps: | 77/206 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 GGRSCWEEE--QEALAKGLEPEDSRWMIMHGSREAALRELQWNNLRIRRQLADLVRCSELGRARI 141
Fly 142 SALDR------------LFQRQTKELVGCR-----------------QDHERVLSFHLTKQ---L 174
Fly 175 EAGKCL----------------QRYRYARDLYASWRELFKMGRHLKEAYKKILERTQSRLEYAEI 223
Fly 224 KRQALDEMTVA 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32650 | NP_727647.1 | DUF4763 | 30..253 | CDD:292582 | 44/206 (21%) |
COQ8B | NP_079152.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 45..86 | 15/51 (29%) | |
KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 | 155..158 | 0/2 (0%) | |||
ABC1_ADCK3 | 175..424 | CDD:270872 | 12/56 (21%) | ||
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 | 216..219 | 1/1 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0661 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |