| Sequence 1: | NP_727647.1 | Gene: | CG32650 / 326227 | FlyBaseID: | FBgn0052650 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_079152.3 | Gene: | COQ8B / 79934 | HGNCID: | 19041 | Length: | 544 | Species: | Homo sapiens |
| Alignment Length: | 206 | Identity: | 44/206 - (21%) |
|---|---|---|---|
| Similarity: | 72/206 - (34%) | Gaps: | 77/206 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 79 GGRSCWEEE--QEALAKGLEPEDSRWMIMHGSREAALRELQWNNLRIRRQLADLVRCSELGRARI 141
Fly 142 SALDR------------LFQRQTKELVGCR-----------------QDHERVLSFHLTKQ---L 174
Fly 175 EAGKCL----------------QRYRYARDLYASWRELFKMGRHLKEAYKKILERTQSRLEYAEI 223
Fly 224 KRQALDEMTVA 234 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32650 | NP_727647.1 | DUF4763 | 30..253 | CDD:292582 | 44/206 (21%) |
| COQ8B | NP_079152.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 45..86 | 15/51 (29%) | |
| KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 | 155..158 | 0/2 (0%) | |||
| ABC1_ADCK3 | 175..424 | CDD:270872 | 12/56 (21%) | ||
| AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 | 216..219 | 1/1 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0661 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||