DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and ADCK1

DIOPT Version :8

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001353416.1 Gene:ADCK1 / 57143 HGNCID:19038 Length:580 Species:Homo sapiens

Alignment Length:154 Identity:36/155 (23%)
Similarity:58/155 (37%) Gaps:26/155 (17%)


  Fly   173 QLEAGKCLQRYRYARDLYASWRELF-KMGRHLKEAYKKILERTQSRLE--YAEIKRQALDEMTVA 234
            ||.:...|:..|...:|..:.|..| |:|:||......:.|...|.|:  :::..:.::.|:...
Human    69 QLRSKVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQV 133

  Fly   235 HEMCLG-STRSLLARVRDLELGLAPLGFSRPSVMSRKIGSLGTSGAGHADSNRAEEHPGRPVWVK 298
            ....|| ....|.....|..||.|.|                      |..::|..|.||.|.||
Human   134 IREDLGKEIHDLFQSFDDTPLGTASL----------------------AQVHKAVLHDGRTVAVK 176

  Fly   299 AKAWQRRSYRTVKFSRGELLELPV 322
            .:..:.|:..:......|:|.|.|
Human   177 VQHPKVRAQSSKDILLMEVLVLAV 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 19/84 (23%)
ADCK1NP_001353416.1 ADCK1-like 117..426 CDD:270871 22/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.