DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and Adck1

DIOPT Version :8

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_017449750.1 Gene:Adck1 / 366698 RGDID:1308263 Length:523 Species:Rattus norvegicus

Alignment Length:154 Identity:38/155 (25%)
Similarity:60/155 (39%) Gaps:38/155 (25%)


  Fly   120 NLRIRRQLADLVRCSELGRARISALDR-LFQRQTKELVGCRQDHERVLSFHLTKQLEAGKCLQRY 183
            |:.:|::       .:.|:|.|..||. |:|..|:|.   |.|:..:....:...|:..|...:.
  Rat   313 NVLVRKR-------PDTGKAEIVLLDHGLYQVLTEEF---RLDYCNLWQSLIWTDLDRVKYYSQR 367

  Fly   184 RYARDLY---------ASWRELFKMGRHLKEAYKKILERTQSRLEYAEIKRQA---LDEMT---- 232
            ..|.|||         .||..: |.|         |.:...|..|.:||:..|   |.|::    
  Rat   368 LGAADLYPLFACMLTARSWASV-KQG---------IGQAPVSATEDSEIRNNAACYLPEISQLLN 422

  Fly   233 -VAHEMCLGSTRSLLARVRDLELG 255
             |..:|.|....:.|.|..:..||
  Rat   423 HVPRQMLLILKTNDLLRSIETTLG 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 36/151 (24%)
Adck1XP_017449750.1 AarF 79..518 CDD:223733 38/155 (25%)
ADCK1-like 122..369 CDD:270871 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.