DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and Adck5

DIOPT Version :8

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001129270.1 Gene:Adck5 / 362943 RGDID:1305504 Length:582 Species:Rattus norvegicus

Alignment Length:283 Identity:49/284 (17%)
Similarity:104/284 (37%) Gaps:82/284 (29%)


  Fly    22 VSDIDG------SVSDGSEELEEQSPEQIEEIAW---------------PQMKREIGAMNRTLDE 65
            |:|::|      :|.|.:.:|.:...|||....:               |..|.|:..::..|.:
  Rat   323 VNDMEGIKSQGLAVQDVATKLIQTFAEQIFHTGFIHSDPHPGNVLVRKGPDGKAELVLLDHGLYQ 387

  Fly    66 IQAQLAIDFHERDGGRSC--WEE---------EQEALAKGLEPEDSRWMIMHG---SREAALREL 116
            .       ..|:|....|  |..         :..|.|.|::.    :|:...   .|...|.:|
  Rat   388 F-------LDEKDRSSLCQLWRAIILRDDAAMKTHAAALGVQD----YMLFSEVLMQRPVRLGQL 441

  Fly   117 QWNNLRIRRQLADLVRCSELGRARISALDRLFQRQTKELVGCRQDHERVLSFHLTKQLEAGKCLQ 181
             |.:..|.|:.|..::  ::.|.....:..:.:...:.::...::...|.:.:.:    .|..:.
  Rat   442 -WGSHLISREEAAYMQ--DMAREHFDGIMEVLKSLPRPMLLVLRNINTVRAINSS----LGTPVD 499

  Fly   182 RY---------RYARDLYASWRELF--KMGRHLKEAYKKILERTQSRLEYAEIKRQALDEMTVAH 235
            ||         .::|.:.|:::.::  ::.||:|..::.:......|||...::..|        
  Rat   500 RYFLMAKSAVWGWSRLVGAAYQGIYSSRLLRHIKVIWEALKFEVILRLEILAMRFTA-------- 556

  Fly   236 EMCLGSTRSLLARVRDLELGLAP 258
                     |:.||. :.||.||
  Rat   557 ---------LMLRVM-VRLGFAP 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 41/263 (16%)
Adck5NP_001129270.1 AarF 128..499 CDD:223733 31/194 (16%)
ADCK1-like 169..420 CDD:270871 19/104 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.