DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and coq8ab

DIOPT Version :8

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_002665174.2 Gene:coq8ab / 327332 ZFINID:ZDB-GENE-030131-5543 Length:567 Species:Danio rerio

Alignment Length:372 Identity:78/373 (21%)
Similarity:129/373 (35%) Gaps:113/373 (30%)


  Fly     8 QSMKRKNELFHHDCVSDIDGSVSDGSEELEEQ--SPEQIEEIAWPQMK--REIG----------A 58
            |:||.        .|||:..:..|..|..||:  :...|.::...:||  ||:.          :
Zfish   228 QTMKM--------VVSDLGPNWQDHLEYFEERPFAAASIGQVHLARMKDGREVAMKIQYPGVAKS 284

  Fly    59 MNRTLDEIQAQLAIDFHERDGGRSCWEEEQEALAKGLEPEDSRWMIMHGSREAALRELQWNNLRI 123
            ::..::.:...|:|               ..||.:||.||.   :|...|||.||........:.
Zfish   285 ISSDINNLLTLLSI---------------SHALPEGLFPEH---LIEVMSRELALECDYIREAKC 331

  Fly   124 RRQLADLVRCSELGRARIS---ALDRLFQRQ--TKELVGCRQDHERVLSFHLTKQLEAGKCLQRY 183
            .::...|::    |....|   .:|.|..:.  |.|||.         .|.|.|..:..:.|:..
Zfish   332 AKKFQQLLK----GHPFFSVPNVVDELSSKHVLTTELVS---------GFPLDKAEDLPQELKNE 383

  Fly   184 RYARDLYASWRELFKMGRHLKEAYKKILERTQSRLEYAEIKRQALDEMTVAHEMCL---GSTRSL 245
            ...:.|....||||:. |::           |:...::..   ..|..|  |::.|   |:||..
Zfish   384 ICEQILILCLRELFEF-RYM-----------QTDPNWSNF---FFDPQT--HKVALLDFGATRGF 431

  Fly   246 LARVRD--LELGLAPLGFSRPSVMSRKIGSLGTSG-------AGHADSNRAEEHPGRPVWVKAKA 301
            .|...|  :|:..|....:|..|:.|.|.....:|       ..|.|:          |.:..:|
Zfish   432 DASFTDTYIEIIKAAADRNREGVLQRSIDMKFLTGYESKSMVNAHVDA----------VMILGEA 486

  Fly   302 WQ-------------RRSYRTVKFSRGELLELPVVVPPEAKTWYGKM 335
            :.             .|.:|.:.....|.|..|   |.|..:.:.||
Zfish   487 FSSDEPFDFGSQSTTERIHRLIPVMLKERLTPP---PEETYSLHRKM 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 52/247 (21%)
coq8abXP_002665174.2 ABC1_ADCK3 212..462 CDD:270872 64/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.