DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and Coq8

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster


Alignment Length:232 Identity:47/232 - (20%)
Similarity:75/232 - (32%) Gaps:64/232 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DGSEELEEQSPEQI---EEIAWPQMKREIGAMNRTLDEIQAQLAID-------FHERDGGRS--- 82
            |...|..|:..|.|   .|...|::.|::...:....|:...:.:|       .|.|....|   
  Fly   427 DREAEYTEKFREMIAPYPEYYVPRVVRDLTTSSVLTTELVPGVPLDKCFDLSYEHRRHIAASVLK 491

  Fly    83 -CWEEEQEALAKGLEPEDSRWMIMHGSREAALRELQWNNLR------IRRQLADLVRCSELGRAR 140
             |..|..|......:|..|.::....||...|  :.:.:.|      ||.....::..:|..|..
  Fly   492 LCLRELFEIECMQTDPNWSNFLYDAPSRRLML--IDFGSTRFYRHEFIRNYRRVIMSAAENNRQG 554

  Fly   141 ISALDR----LFQRQTKELVGCRQDHERVLSFHLTKQLEAGKCLQRYRYARDLYASWRELFKMGR 201
            :..:.|    |...:||::.....|...:|.             :.:||..|        |..||
  Fly   555 VLEMSREMGFLTGYETKQMEQAHVDAVMILG-------------EIFRYDGD--------FDFGR 598

  Fly   202 HLKEAYKKILERTQSRLEYAEIKRQALDEMTVAHEMC 238
                      :.|..||       .||....|||.:|
  Fly   599 ----------QNTTERL-------AALVPTMVAHRLC 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 47/232 (20%)
Coq8NP_572836.1 AarF 262..641 CDD:223733 47/232 (20%)
ABC1_ADCK3 313..563 CDD:270872 27/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.