DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sk2 and TIM54

DIOPT Version :10

Sequence 1:NP_647762.3 Gene:Sk2 / 326219 FlyBaseID:FBgn0052484 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_012481.3 Gene:TIM54 / 853392 SGDID:S000003590 Length:478 Species:Saccharomyces cerevisiae


Alignment Length:44 Identity:13/44 - (29%)
Similarity:23/44 - (52%) Gaps:2/44 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 VDERRRRVLVLLNPKSGS--GDAREVFNMHVTPVLNEAEVPYDL 251
            ||:..|::.|.:.|....  ..:.:|:..:|.|||..|.:.|:|
Yeast    80 VDKVPRKITVFIAPPPNDYLESSLKVWRRYVKPVLYYAGLDYEL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sk2NP_647762.3 PLN02958 <213..639 CDD:215517 11/41 (27%)
TIM54NP_012481.3 Tim54 20..466 CDD:463328 13/44 (30%)

Return to query results.
Submit another query.