DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atox1 and ATX1

Sequence 1:NP_001262184.1 Gene:Atox1 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_564870.1 Gene:ATX1 AraportID:AT1G66240 Length:106 Species:Arabidopsis thaliana

Alignment Length:60 Identity:24/61 (39%)
Similarity:42/61 (69%) Gaps:1/61 (2%)


  Fly     7 KVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTY 66
            :|.|||.||..||:|||||: :.||..:::::::.|:|..|:..|.:::.:.||||.|.:
plant    38 RVAMTCEGCVGAVKRVLGKM-EGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAF 96

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 22/55 (40%)
ATX1NP_564870.1 HMA 36..93 CDD:238219 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1564517at2759
OrthoInspector 1 1.000 T193704
orthoMCL 1 0.900 OOG5_130576
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.