DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and HMA5

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_176533.1 Gene:HMA5 / 842650 AraportID:AT1G63440 Length:995 Species:Arabidopsis thaliana


Alignment Length:90 Identity:25/90 - (27%)
Similarity:41/90 - (45%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MTCGGCASAVERVLGKL-GDKVEKVNINLEDRTVSVTSNLSS-DELMEQLR---------KTGKS 63
            |||..|:|.:||||..: |.:...|.:.:|:..:.....||| |.|:|::.         .||:.
plant   138 MTCTSCSSTIERVLQSVNGVQRAHVALAIEEAEIHYDPRLSSYDRLLEEIENAGFEAVLISTGED 202

  Fly    64 TTYVGVKKXDEFLSKFQKYGRLKLE 88
            .:.:.:|. .|...:..|.....||
plant   203 VSKIDLKIDGELTDESMKVIERSLE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 19/62 (31%)
HMA5NP_176533.1 HMA 54..117 CDD:238219
HMA 133..194 CDD:238219 18/55 (33%)
HMA <222..265 CDD:238219 2/6 (33%)
P-type_ATPase_Cu-like 298..975 CDD:319783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.