powered by:
Protein Alignment Atox1 and HIPP22
DIOPT Version :9
Sequence 1: | NP_001262184.1 |
Gene: | Atox1 / 326216 |
FlyBaseID: | FBgn0052446 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_173712.1 |
Gene: | HIPP22 / 838907 |
AraportID: | AT1G22990 |
Length: | 152 |
Species: | Arabidopsis thaliana |
Alignment Length: | 63 |
Identity: | 15/63 - (23%) |
Similarity: | 32/63 - (50%) |
Gaps: | 3/63 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTVHEFKVEMTCGGCASAVERVLGKL-GDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGK 62
|.....||::.|.||...::..:..: |.| .|.:|.:...|:|:..:...::::.::.|||
plant 28 MQTVNIKVKIDCDGCERKIKNAVSSIKGAK--SVEVNRKMHKVTVSGYVDPKKVLKTVQSTGK 88
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Atox1 | NP_001262184.1 |
HMA |
5..62 |
CDD:238219 |
12/57 (21%) |
HIPP22 | NP_173712.1 |
HMA |
37..89 |
CDD:238219 |
12/54 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1603 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.770 |
|
Return to query results.
Submit another query.