DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and HIPP22

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_173712.1 Gene:HIPP22 / 838907 AraportID:AT1G22990 Length:152 Species:Arabidopsis thaliana


Alignment Length:63 Identity:15/63 - (23%)
Similarity:32/63 - (50%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEFKVEMTCGGCASAVERVLGKL-GDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGK 62
            |.....||::.|.||...::..:..: |.|  .|.:|.:...|:|:..:...::::.::.|||
plant    28 MQTVNIKVKIDCDGCERKIKNAVSSIKGAK--SVEVNRKMHKVTVSGYVDPKKVLKTVQSTGK 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 12/57 (21%)
HIPP22NP_173712.1 HMA 37..89 CDD:238219 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.