DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atox1 and HIPP27

Sequence 1:NP_001262184.1 Gene:Atox1 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001332183.1 Gene:HIPP27 AraportID:AT5G66110 Length:147 Species:Arabidopsis thaliana

Alignment Length:60 Identity:18/61 (30%)
Similarity:32/61 (52%) Gaps:4/61 (7%)


  Fly     5 EFKVEMTCGGCASAVER-VLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQ-LRKTGK 62
            |.||:|.|.||...|.: |.|..|  |.||.::.:...::|...:...:::.: :.:|||
plant    22 EIKVKMDCEGCERRVRKSVEGMKG--VSKVTVDPKQSKLTVEGFVQPSKVVHRVMHRTGK 79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 17/59 (29%)
HIPP27NP_001332183.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.