DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and HIPP27

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_201412.2 Gene:HIPP27 / 836743 AraportID:AT5G66110 Length:147 Species:Arabidopsis thaliana


Alignment Length:60 Identity:18/60 - (30%)
Similarity:32/60 - (53%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFKVEMTCGGCASAVER-VLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQ-LRKTGK 62
            |.||:|.|.||...|.: |.|..|  |.||.::.:...::|...:...:::.: :.:|||
plant    22 EIKVKMDCEGCERRVRKSVEGMKG--VSKVTVDPKQSKLTVEGFVQPSKVVHRVMHRTGK 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 15/57 (26%)
HIPP27NP_201412.2 HMA 22..82 CDD:238219 18/60 (30%)

Return to query results.
Submit another query.